Recombinant Human PLXNA2
Cat.No. : | PLXNA2-30876TH |
Product Overview : | Recombinant fragment Human Plexin A2 with N-terminal proprietary tag. Predicted MW 44.15kDa. |
Availability | June 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 165 amino acids |
Description : | This gene encodes a member of the plexin-A family of semaphorin co-receptors. Semaphorins are a large family of secreted or membrane-bound proteins that mediate repulsive effects on axon pathfinding during nervous system development. A subset of semaphorins are recognized by plexin-A/neuropilin transmembrane receptor complexes, triggering a cellular signal transduction cascade that leads to axon repulsion. This plexin-A family member is thought to transduce signals from semaphorin-3A and -3C. |
Molecular Weight : | 44.150kDa inclusive of tags |
Tissue specificity : | Detected in fetal brain. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MHSQVFSAFPYSLPLRFWVNVIKNPQFVFDIHKGSITDAC LSVVAQTFMDSCSTSEHRLDKDSPSNKLLYAKDIPSYKSW VERYYADIAKLPAISDQDMNAYLAEQSRLHAVEFNMLSAL NEIYSYVSKYSEELIGALEQDEQARRQRLAYKVEQLINAM SIES |
Sequence Similarities : | Belongs to the plexin family.Contains 4 IPT/TIG domains.Contains 1 Sema domain. |
Gene Name | PLXNA2 plexin A2 [ Homo sapiens ] |
Official Symbol | PLXNA2 |
Synonyms | PLXNA2; plexin A2; PLXN2; plexin-A2; FLJ11751; FLJ30634; KIAA0463; OCT; plexin 2; semaphorin receptor OCT; transmembrane protein OCT; |
Gene ID | 5362 |
mRNA Refseq | NM_025179 |
Protein Refseq | NP_079455 |
MIM | 601054 |
Uniprot ID | O75051 |
Chromosome Location | 1q32.2 |
Pathway | Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; Axon guidance, organism-specific biosystem; Axon guidance, organism-specific biosystem; CRMPs in Sema3A signaling, organism-specific biosystem; |
Function | receptor activity; semaphorin receptor activity; |
◆ Recombinant Proteins | ||
Plxna2-441M | Active Recombinant Mouse Plxna2, His-tagged | +Inquiry |
PLXNA2-001H | Recombinant Human plexin A2 Protein, His-tagged | +Inquiry |
PLXNA2-6865M | Recombinant Mouse PLXNA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PLXNA2-20H | Recombinant Human PLXNA2 protein(Thr861- Val1220), His-tagged | +Inquiry |
PLXNA2-312H | Recombinant Human Plexin A2 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLXNA2 Products
Required fields are marked with *
My Review for All PLXNA2 Products
Required fields are marked with *
0
Inquiry Basket