Recombinant Human PLXNA2
| Cat.No. : | PLXNA2-30876TH |
| Product Overview : | Recombinant fragment Human Plexin A2 with N-terminal proprietary tag. Predicted MW 44.15kDa. |
| Availability | January 06, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 165 amino acids |
| Description : | This gene encodes a member of the plexin-A family of semaphorin co-receptors. Semaphorins are a large family of secreted or membrane-bound proteins that mediate repulsive effects on axon pathfinding during nervous system development. A subset of semaphorins are recognized by plexin-A/neuropilin transmembrane receptor complexes, triggering a cellular signal transduction cascade that leads to axon repulsion. This plexin-A family member is thought to transduce signals from semaphorin-3A and -3C. |
| Molecular Weight : | 44.150kDa inclusive of tags |
| Tissue specificity : | Detected in fetal brain. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MHSQVFSAFPYSLPLRFWVNVIKNPQFVFDIHKGSITDAC LSVVAQTFMDSCSTSEHRLDKDSPSNKLLYAKDIPSYKSW VERYYADIAKLPAISDQDMNAYLAEQSRLHAVEFNMLSAL NEIYSYVSKYSEELIGALEQDEQARRQRLAYKVEQLINAM SIES |
| Sequence Similarities : | Belongs to the plexin family.Contains 4 IPT/TIG domains.Contains 1 Sema domain. |
| Gene Name | PLXNA2 plexin A2 [ Homo sapiens ] |
| Official Symbol | PLXNA2 |
| Synonyms | PLXNA2; plexin A2; PLXN2; plexin-A2; FLJ11751; FLJ30634; KIAA0463; OCT; plexin 2; semaphorin receptor OCT; transmembrane protein OCT; |
| Gene ID | 5362 |
| mRNA Refseq | NM_025179 |
| Protein Refseq | NP_079455 |
| MIM | 601054 |
| Uniprot ID | O75051 |
| Chromosome Location | 1q32.2 |
| Pathway | Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; Axon guidance, organism-specific biosystem; Axon guidance, organism-specific biosystem; CRMPs in Sema3A signaling, organism-specific biosystem; |
| Function | receptor activity; semaphorin receptor activity; |
| ◆ Recombinant Proteins | ||
| PLXNA2-21H | Recombinant Human PLXNA2 protein(Thr861- Val1220), SUMO &His-tagged | +Inquiry |
| Plxna2-5102M | Recombinant Mouse Plxna2 protein | +Inquiry |
| Plxna2-5101M | Recombinant Mouse Plxna2 protein, Avi-tagged, Biotinylated | +Inquiry |
| PLXNA2-30876TH | Recombinant Human PLXNA2 | +Inquiry |
| PLXNA2-23H | Recombinant Human plexin A2 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLXNA2 Products
Required fields are marked with *
My Review for All PLXNA2 Products
Required fields are marked with *
