Recombinant Human PMCH, His-tagged

Cat.No. : PMCH-172H
Product Overview : Recombinant Human Pro-MCH/PMCH is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Ile22-Val165) of Human PMCH fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 22-165 a.a.
Description : Melanin-Concentrating Hormone (MCH) is a cyclic neuropeptide that belongs to the melanin-concentrating hormone family. It is isolated initially from salmon pituitary gland and later from rat hypothalamus. MCH is predominantly expressed in lateral hypothalamus, it is also detected in pallidum, neocortex and cerebellum. In mammals, MCH perikarya are confined largely to the lateral hypothalamus and zona incerta area with extensive neuronal projections throughout the brain, including the neurohypophysis. The anatomic distribution suggests MCH may act as a neurotransmitter or neuromodulator in a broad array of neuronal functions directed toward the regulation of goal-directed behavior, such as food intake, and general arousal. It may also play a role in spermatocyte differentiation.
Form : Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.4
AA Sequence : ILLSASKSIRNLDDDMVFNTFRLGKGFQKEDTAEKSVIAPSLEQYKNDESSFMNEEENKVSKNTG SKHNFLNHGLPLNLAIKPYLALKGSVAFPAENGVQNTESTQEKREIGDEENSAKFPIGRRDFDML RCMLGRVYRPCWQVVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name PMCH pro-melanin-concentrating hormone [ Homo sapiens ]
Official Symbol PMCH
Synonyms PMCH; pro-melanin-concentrating hormone; pro-MCH; MCH;
Gene ID 5367
mRNA Refseq NM_002674
Protein Refseq NP_002665
MIM 176795
UniProt ID P20382
Chromosome Location 12q23.2
Pathway Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; Peptide ligand-binding receptors, organism-specific biosystem; Signal Transduction, organism-specific biosystem;
Function melanin-concentrating hormone activity; type 1 melanin-concentrating hormone receptor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PMCH Products

Required fields are marked with *

My Review for All PMCH Products

Required fields are marked with *

0
cart-icon
0
compare icon