Recombinant Human PMCH, His-tagged
Cat.No. : | PMCH-172H |
Product Overview : | Recombinant Human Pro-MCH/PMCH is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Ile22-Val165) of Human PMCH fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 22-165 a.a. |
Description : | Melanin-Concentrating Hormone (MCH) is a cyclic neuropeptide that belongs to the melanin-concentrating hormone family. It is isolated initially from salmon pituitary gland and later from rat hypothalamus. MCH is predominantly expressed in lateral hypothalamus, it is also detected in pallidum, neocortex and cerebellum. In mammals, MCH perikarya are confined largely to the lateral hypothalamus and zona incerta area with extensive neuronal projections throughout the brain, including the neurohypophysis. The anatomic distribution suggests MCH may act as a neurotransmitter or neuromodulator in a broad array of neuronal functions directed toward the regulation of goal-directed behavior, such as food intake, and general arousal. It may also play a role in spermatocyte differentiation. |
Form : | Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.4 |
AA Sequence : | ILLSASKSIRNLDDDMVFNTFRLGKGFQKEDTAEKSVIAPSLEQYKNDESSFMNEEENKVSKNTG SKHNFLNHGLPLNLAIKPYLALKGSVAFPAENGVQNTESTQEKREIGDEENSAKFPIGRRDFDML RCMLGRVYRPCWQVVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | PMCH pro-melanin-concentrating hormone [ Homo sapiens ] |
Official Symbol | PMCH |
Synonyms | PMCH; pro-melanin-concentrating hormone; pro-MCH; MCH; |
Gene ID | 5367 |
mRNA Refseq | NM_002674 |
Protein Refseq | NP_002665 |
MIM | 176795 |
UniProt ID | P20382 |
Chromosome Location | 12q23.2 |
Pathway | Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; Peptide ligand-binding receptors, organism-specific biosystem; Signal Transduction, organism-specific biosystem; |
Function | melanin-concentrating hormone activity; type 1 melanin-concentrating hormone receptor binding; |
◆ Recombinant Proteins | ||
PMCH-646H | Recombinant Human PMCH Protein, His-tagged | +Inquiry |
PMCH-4540R | Recombinant Rat PMCH Protein | +Inquiry |
PMCH-8000Z | Recombinant Zebrafish PMCH | +Inquiry |
PMCH-4155C | Recombinant Chicken PMCH | +Inquiry |
PMCH-4200R | Recombinant Rat PMCH Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PMCH-488HCL | Recombinant Human PMCH lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PMCH Products
Required fields are marked with *
My Review for All PMCH Products
Required fields are marked with *