Recombinant Human PML protein, His-tagged
Cat.No. : | PML-4481H |
Product Overview : | Recombinant Human PML protein(P29590)(59-239aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 59-239aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 26.4 kDa |
AA Sequence : | QCQAEAKCPKLLPCLHTLCSGCLEASGMQCPICQAPWPLGADTPALDNVFFESLQRRLSVYRQIVDAQAVCTRCKESADFWCFECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLDGTRKTNNIFCSNPNHRTPTLTSIYCRGCSKPLCCSCALLDSSHSELKCDISAEIQQRQEE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | PML promyelocytic leukemia [ Homo sapiens ] |
Official Symbol | PML |
Synonyms | PML; promyelocytic leukemia; protein PML; MYL; RNF71; TRIM19; RING finger protein 71; promyelocytic leukemia protein; tripartite motif protein TRIM19; probable transcription factor PML; promyelocytic leukemia, inducer of; tripartite motif-containing protein 19; PP8675; |
Gene ID | 5371 |
mRNA Refseq | NM_033238 |
Protein Refseq | NP_150241 |
MIM | 102578 |
UniProt ID | P29590 |
◆ Recombinant Proteins | ||
PML-1157H | Recombinant Human PML Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PML-1158H | Recombinant Human PML Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PML-3483R | Recombinant Rhesus monkey PML Protein, His-tagged | +Inquiry |
PML-30738TH | Recombinant Human PML | +Inquiry |
PML-2250H | Recombinant Human PML protein, His&Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PML Products
Required fields are marked with *
My Review for All PML Products
Required fields are marked with *
0
Inquiry Basket