Recombinant Human PML protein, His-tagged

• Cat.No.: PML-4481H
• Product Overview: Recombinant Human PML protein(P29590)(59-239aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 59-239aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 26.4 kDa
• AA Sequence: QCQAEAKCPKLLPCLHTLCSGCLEASGMQCPICQAPWPLGADTPALDNVFFESLQRRLSVYRQIVDAQAVCTRCKESADFWCFECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLDGTRKTNNIFCSNPNHRTPTLTSIYCRGCSKPLCCSCALLDSSHSELKCDISAEIQQRQEE
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: PML promyelocytic leukemia [ Homo sapiens ]
• Official Symbol: PML
• Synonyms: PML; promyelocytic leukemia; protein PML; MYL; RNF71; TRIM19; RING finger protein 71; promyelocytic leukemia protein; tripartite motif protein TRIM19; probable transcription factor PML; promyelocytic leukemia, inducer of; tripartite motif-containing protein 19; PP8675
• Gene ID: 5371
• mRNA Refseq: NM_033238
• Protein Refseq: NP_150241
• MIM: 102578
• UniProt ID: P29590