Recombinant Human PML
Cat.No. : | PML-30738TH |
Product Overview : | Recombinant fragment corresponding to amino acids 411-510 of Human PML Protein with proprietary tag; Predicted MWt 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This phosphoprotein localizes to nuclear bodies where it functions as a transcription factor and tumor suppressor. Its expression is cell-cycle related and it regulates the p53 response to oncogenic signals. The gene is often involved in the translocation with the retinoic acid receptor alpha gene associated with acute promyelocytic leukemia (APL). Extensive alternative splicing of this gene results in several variations of the proteins central and C-terminal regions; all variants encode the same N-terminus. Alternatively spliced transcript variants encoding different isoforms have been identified. |
Molecular Weight : | 36.630kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | RDPIDVDLDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVV |
Sequence Similarities : | Contains 2 B box-type zinc fingers.Contains 1 RING-type zinc finger. |
Gene Name | PML promyelocytic leukemia [ Homo sapiens ] |
Official Symbol | PML |
Synonyms | PML; promyelocytic leukemia; protein PML; MYL; RNF71; TRIM19; |
Gene ID | 5371 |
mRNA Refseq | NM_002675 |
Protein Refseq | NP_002666 |
MIM | 102578 |
Uniprot ID | P29590 |
Chromosome Location | 15q24.1 |
Pathway | Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Direct p53 effectors, organism-specific biosystem; Endocytosis, organism-specific biosystem; |
Function | DNA binding; SMAD binding; SUMO binding; cobalt ion binding; metal ion binding; |
◆ Recombinant Proteins | ||
PML-5516H | Recombinant Human PML Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PML-1957HFL | Recombinant Full Length Human PML protein, Flag-tagged | +Inquiry |
PML-2375H | Recombinant Human Promyelocytic Leukemia, GST-tagged | +Inquiry |
PML-3301R | Recombinant Rhesus Macaque PML Protein, His (Fc)-Avi-tagged | +Inquiry |
PML-30738TH | Recombinant Human PML | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PML Products
Required fields are marked with *
My Review for All PML Products
Required fields are marked with *