Recombinant Human PML

Cat.No. : PML-30738TH
Product Overview : Recombinant fragment corresponding to amino acids 411-510 of Human PML Protein with proprietary tag; Predicted MWt 36.63 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This phosphoprotein localizes to nuclear bodies where it functions as a transcription factor and tumor suppressor. Its expression is cell-cycle related and it regulates the p53 response to oncogenic signals. The gene is often involved in the translocation with the retinoic acid receptor alpha gene associated with acute promyelocytic leukemia (APL). Extensive alternative splicing of this gene results in several variations of the proteins central and C-terminal regions; all variants encode the same N-terminus. Alternatively spliced transcript variants encoding different isoforms have been identified.
Molecular Weight : 36.630kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : RDPIDVDLDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVV
Sequence Similarities : Contains 2 B box-type zinc fingers.Contains 1 RING-type zinc finger.
Gene Name PML promyelocytic leukemia [ Homo sapiens ]
Official Symbol PML
Synonyms PML; promyelocytic leukemia; protein PML; MYL; RNF71; TRIM19;
Gene ID 5371
mRNA Refseq NM_002675
Protein Refseq NP_002666
MIM 102578
Uniprot ID P29590
Chromosome Location 15q24.1
Pathway Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Direct p53 effectors, organism-specific biosystem; Endocytosis, organism-specific biosystem;
Function DNA binding; SMAD binding; SUMO binding; cobalt ion binding; metal ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PML Products

Required fields are marked with *

My Review for All PML Products

Required fields are marked with *

0

Inquiry Basket

cartIcon