Recombinant Human PMS1 protein, His-tagged

Cat.No. : PMS1-3319H
Product Overview : Recombinant Human PMS1 protein(340-616 aa), fused to His tag, was expressed in E. coli.
Availability April 30, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 340-616 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : LPSTNSYENNKTDVSAADIVLSKTAETDVLFNKVESSGKNYSNVDTSVIPFQNDMHNDESGKNTDDCLNHQISIGDFGYGHCSSEISNIDKNTKNAFQDISMSNVSWENSQTEYSKTCFISSVKHTQSENGNKDHIDESGENEEEAGLENSSEISADEWSRGNILKNSVGENIEPVKILVPEKSLPCKVSNNNYPIPEQMNLNEDSCNKKSNVIDNKSGKVTAYDLLSNRVIKKPMSASALFVQDHRPQFLIENPKTSLEDATLQIEELWKTLSEEE
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name PMS1 PMS1 postmeiotic segregation increased 1 (S. cerevisiae) [ Homo sapiens ]
Official Symbol PMS1
Synonyms PMS1; PMS1 postmeiotic segregation increased 1 (S. cerevisiae); PMSL1, postmeiotic segregation increased (S. cerevisiae) 1; PMS1 protein homolog 1; mismatch repair gene PMSL1; human homolog of yeast mutL; DNA mismatch repair protein PMS1; rhabdomyosarcoma antigen MU-RMS-40.10B; rhabdomyosarcoma antigen MU-RMS-40.10E; PMSL1; hPMS1; HNPCC3; FLJ98259; DKFZp781M0253;
Gene ID 5378
mRNA Refseq NM_000534
Protein Refseq NP_000525
MIM 600258
UniProt ID P54277

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PMS1 Products

Required fields are marked with *

My Review for All PMS1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon