Recombinant Human PMVK, His-tagged
| Cat.No. : | PMVK-30070TH |
| Product Overview : | Recombinant full length protein, corresponding to amino acids 1-192 of Human PMVK with N terminal His tag, 24kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-192 a.a. |
| Description : | This gene encodes a peroxisomal enzyme that catalyzes the conversion of mevalonate 5-phosphate into mevalonate 5-diphosphate, the fifth reaction of the cholesterol biosynthetic pathway. Studies in rat show that the message level and the enzyme activity of this protein is regulated by sterol, and that this regulation is coordinated with 3-hydroxy-3-methylglutaryl coenzyme A reductase, the rate-limiting enzyme of cholesterol biosynthesis. |
| Conjugation : | HIS |
| Tissue specificity : | Heart, liver, skeletal muscle, kidney, and pancreas. Lower level in brain, placenta and lung. |
| Form : | Lyophilised:Reconstitute with 61 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAV LRLSGPLKEQYAQEHGLNFQRLLDTSTYKEAFRKDMIR WGEEKRQADPGFFCRKIVEGISQPIWLVSDTRRVSDIQWFREAYGAVTQTVRVVALEQSRQQRGWVFTPGVDDAESEC GLDNFGDFDWVIENHGVEQRLEEQLENLIEFIRSRL |
| Full Length : | Full L. |
| Gene Name | PMVK phosphomevalonate kinase [ Homo sapiens ] |
| Official Symbol | PMVK |
| Synonyms | PMVK; phosphomevalonate kinase; HUMPMKI; PMK; PMKA; |
| Gene ID | 10654 |
| mRNA Refseq | NM_006556 |
| Protein Refseq | NP_006547 |
| MIM | 607622 |
| Uniprot ID | Q15126 |
| Chromosome Location | 1p13-q23 |
| Pathway | C5 isoprenoid biosynthesis, mevalonate pathway, organism-specific biosystem; C5 isoprenoid biosynthesis, mevalonate pathway, conserved biosystem; Cholesterol Biosynthesis, organism-specific biosystem; Cholesterol biosynthesis, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; |
| Function | ATP binding; nucleotide binding; phosphomevalonate kinase activity; transferase activity; |
| ◆ Recombinant Proteins | ||
| PMVK-6131H | Recombinant Human PMVK Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| PMVK-2823H | Recombinant Human Phosphomevalonate Kinase, His-tagged | +Inquiry |
| PMVK-1812H | Recombinant Human PMVK, GST-tagged | +Inquiry |
| PMVK-444H | Recombinant Human PMVK, His tagged | +Inquiry |
| Pmvk-4960M | Recombinant Mouse Pmvk Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PMVK-3084HCL | Recombinant Human PMVK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PMVK Products
Required fields are marked with *
My Review for All PMVK Products
Required fields are marked with *
