Recombinant Human PMVK, His-tagged

Cat.No. : PMVK-30070TH
Product Overview : Recombinant full length protein, corresponding to amino acids 1-192 of Human PMVK with N terminal His tag, 24kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-192 a.a.
Description : This gene encodes a peroxisomal enzyme that catalyzes the conversion of mevalonate 5-phosphate into mevalonate 5-diphosphate, the fifth reaction of the cholesterol biosynthetic pathway. Studies in rat show that the message level and the enzyme activity of this protein is regulated by sterol, and that this regulation is coordinated with 3-hydroxy-3-methylglutaryl coenzyme A reductase, the rate-limiting enzyme of cholesterol biosynthesis.
Conjugation : HIS
Tissue specificity : Heart, liver, skeletal muscle, kidney, and pancreas. Lower level in brain, placenta and lung.
Form : Lyophilised:Reconstitute with 61 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAV LRLSGPLKEQYAQEHGLNFQRLLDTSTYKEAFRKDMIR WGEEKRQADPGFFCRKIVEGISQPIWLVSDTRRVSDIQWFREAYGAVTQTVRVVALEQSRQQRGWVFTPGVDDAESEC GLDNFGDFDWVIENHGVEQRLEEQLENLIEFIRSRL
Full Length : Full L.
Gene Name PMVK phosphomevalonate kinase [ Homo sapiens ]
Official Symbol PMVK
Synonyms PMVK; phosphomevalonate kinase; HUMPMKI; PMK; PMKA;
Gene ID 10654
mRNA Refseq NM_006556
Protein Refseq NP_006547
MIM 607622
Uniprot ID Q15126
Chromosome Location 1p13-q23
Pathway C5 isoprenoid biosynthesis, mevalonate pathway, organism-specific biosystem; C5 isoprenoid biosynthesis, mevalonate pathway, conserved biosystem; Cholesterol Biosynthesis, organism-specific biosystem; Cholesterol biosynthesis, organism-specific biosystem; Metabolic pathways, organism-specific biosystem;
Function ATP binding; nucleotide binding; phosphomevalonate kinase activity; transferase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PMVK Products

Required fields are marked with *

My Review for All PMVK Products

Required fields are marked with *

0
cart-icon