Recombinant Human PNLIPRP2

Cat.No. : PNLIPRP2-30778TH
Product Overview : Recombinant fragment corresponding to amino acids 333-435 of Human Pancreatic Lipase Related Protein 2 with an N-terminal proprietary tag; predicted MWt 36.96 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 103 amino acids
Molecular Weight : 36.960kDa inclusive of tags
Tissue specificity : Pancreas.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : FKGKTSAVEQTFFLNTGESGNFTSWRYKVSVTLSGKEKVN GYIRIALYGSNENSKQYEIFKGSLKPDASHTCAIDVDFNV GKIQKVKFLWNKRGINLSEPKLG
Sequence Similarities : Belongs to the AB hydrolase superfamily. Lipase family.Contains 1 PLAT domain.
Gene Name PNLIPRP2 pancreatic lipase-related protein 2 [ Homo sapiens ]
Official Symbol PNLIPRP2
Synonyms PNLIPRP2; pancreatic lipase-related protein 2; PLRP2;
Gene ID 5408
mRNA Refseq NM_005396
Protein Refseq NP_005387
MIM 604423
Uniprot ID P54317
Chromosome Location 10q26.12
Pathway Acylglycerol degradation, organism-specific biosystem; Acylglycerol degradation, conserved biosystem; Digestion of dietary lipid, organism-specific biosystem; Fat digestion and absorption, organism-specific biosystem; Fat digestion and absorption, conserved biosystem;
Function acylglycerol lipase activity; calcium ion binding; galactolipase activity; hydrolase activity; phospholipase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PNLIPRP2 Products

Required fields are marked with *

My Review for All PNLIPRP2 Products

Required fields are marked with *

0
cart-icon
0
compare icon