Recombinant Human PNLIPRP2

• Cat.No.: PNLIPRP2-30778TH
• Product Overview: Recombinant fragment corresponding to amino acids 333-435 of Human Pancreatic Lipase Related Protein 2 with an N-terminal proprietary tag; predicted MWt 36.96 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 103 amino acids
• Molecular Weight: 36.960kDa inclusive of tags
• Tissue specificity: Pancreas.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: FKGKTSAVEQTFFLNTGESGNFTSWRYKVSVTLSGKEKVN GYIRIALYGSNENSKQYEIFKGSLKPDASHTCAIDVDFNV GKIQKVKFLWNKRGINLSEPKLG
• Sequence Similarities: Belongs to the AB hydrolase superfamily. Lipase family.Contains 1 PLAT domain.

Gene Information

• Gene Name: PNLIPRP2 pancreatic lipase-related protein 2 [ Homo sapiens ]
• Official Symbol: PNLIPRP2
• Synonyms: PNLIPRP2; pancreatic lipase-related protein 2; PLRP2
• Gene ID: 5408
• mRNA Refseq: NM_005396
• Protein Refseq: NP_005387
• MIM: 604423
• Uniprot ID: P54317
• Chromosome Location: 10q26.12
• Pathway: Acylglycerol degradation, organism-specific biosystem; Acylglycerol degradation, conserved biosystem; Digestion of dietary lipid, organism-specific biosystem; Fat digestion and absorption, organism-specific biosystem; Fat digestion and absorption, conserved biosystem
• Function: acylglycerol lipase activity; calcium ion binding; galactolipase activity; hydrolase activity; phospholipase activity