Recombinant Human PNLIPRP2
| Cat.No. : | PNLIPRP2-30778TH |
| Product Overview : | Recombinant fragment corresponding to amino acids 333-435 of Human Pancreatic Lipase Related Protein 2 with an N-terminal proprietary tag; predicted MWt 36.96 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 103 amino acids |
| Molecular Weight : | 36.960kDa inclusive of tags |
| Tissue specificity : | Pancreas. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | FKGKTSAVEQTFFLNTGESGNFTSWRYKVSVTLSGKEKVN GYIRIALYGSNENSKQYEIFKGSLKPDASHTCAIDVDFNV GKIQKVKFLWNKRGINLSEPKLG |
| Sequence Similarities : | Belongs to the AB hydrolase superfamily. Lipase family.Contains 1 PLAT domain. |
| Gene Name | PNLIPRP2 pancreatic lipase-related protein 2 [ Homo sapiens ] |
| Official Symbol | PNLIPRP2 |
| Synonyms | PNLIPRP2; pancreatic lipase-related protein 2; PLRP2; |
| Gene ID | 5408 |
| mRNA Refseq | NM_005396 |
| Protein Refseq | NP_005387 |
| MIM | 604423 |
| Uniprot ID | P54317 |
| Chromosome Location | 10q26.12 |
| Pathway | Acylglycerol degradation, organism-specific biosystem; Acylglycerol degradation, conserved biosystem; Digestion of dietary lipid, organism-specific biosystem; Fat digestion and absorption, organism-specific biosystem; Fat digestion and absorption, conserved biosystem; |
| Function | acylglycerol lipase activity; calcium ion binding; galactolipase activity; hydrolase activity; phospholipase activity; |
| ◆ Recombinant Proteins | ||
| PNLIPRP2-573H | Recombinant Human PNLIPRP2 Protein, His-tagged | +Inquiry |
| PNLIPRP2-28234TH | Recombinant Human PNLIPRP2 | +Inquiry |
| PNLIPRP2-376HF | Recombinant Full Length Human PNLIPRP2 Protein | +Inquiry |
| PNLIPRP2-2413H | Recombinant Human PNLIPRP2 Protein, MYC/DDK-tagged | +Inquiry |
| PNLIPRP2-8605H | Recombinant Human PNLIPRP2, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PNLIPRP2-1281HCL | Recombinant Human PNLIPRP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PNLIPRP2 Products
Required fields are marked with *
My Review for All PNLIPRP2 Products
Required fields are marked with *
