Recombinant Human PNP Protein, GST-tagged
Cat.No. : | PNP-832H |
Product Overview : | Recombinant Human PNP Protien(NP_000261)(1-289 aa), fused to GST tag, was expressed in E. coli. |
Availability | July 06, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-289 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Gene Name | PNP purine nucleoside phosphorylase [ Homo sapiens ] |
Official Symbol | PNP |
Synonyms | PNP; purine nucleoside phosphorylase; NP, nucleoside phosphorylase; PUNP; inosine phosphorylase; purine-nucleoside:orthophosphate ribosyltransferase; NP; PRO1837; FLJ94043; FLJ97288; FLJ97312; MGC117396; MGC125915; MGC125916; |
Gene ID | 4860 |
mRNA Refseq | NM_000270 |
Protein Refseq | NP_000261 |
MIM | 164050 |
UniProt ID | P00491 |
◆ Recombinant Proteins | ||
PNP-150H | Active Recombinant Human PNP, His-tagged | +Inquiry |
Pnp-4971M | Recombinant Mouse Pnp Protein, Myc/DDK-tagged | +Inquiry |
PNP-4090H | Recombinant Human PNP protein, His-SUMO-tagged | +Inquiry |
PNP-715HFL | Active Recombinant Full Length Human PNP Protein, C-Flag-tagged | +Inquiry |
PNP-2498H | Recombinant Human PNP protein(11-280 aa), C-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PNP-3071HCL | Recombinant Human PNP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PNP Products
Required fields are marked with *
My Review for All PNP Products
Required fields are marked with *