Recombinant Human PNPLA3 protein, His&Myc-tagged
| Cat.No. : | PNPLA3-754H |
| Product Overview : | Recombinant Human PNPLA3 protein(Q9NST1)(63-481aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 63-481a.a. |
| Tag : | His&Myc |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 53.7 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | EQTLQVLSDLVRKARSRNIGIFHPSFNLSKFLRQGLCKCLPANVHQLISGKIGISLTRVSDGENVLVSDFRSKDEVVDALVCSCFIPFYSGLIPPSFRGVRYVDGGVSDNVPFIDAKTTITVSPFYGEYDICPKVKSTNFLHVDITKLSLRLCTGNLYLLSRAFVPPDLKVLGEICLRGYLDAFRFLEEKGICNRPQPGLKSSSEGMDPEVAMPSWANMSLDSSPESAALAVRLEGDELLDHLRLSILPWDESILDTLSPRLATALSEEMKDKGGYMSKICNLLPIRIMSYVMLPCTLPVESAIAIVQRLVTWLPDMPDDVLWLQWVTSQVFTRVLMCLLPASRSQMPVSSQQASPCTPEQDWPCWTPCSPKGCPAETKAEATPRSILRSSLNFFLGNKVPAGAEGLSTFPSFSLEKSL |
| Gene Name | PNPLA3 patatin-like phospholipase domain containing 3 [ Homo sapiens ] |
| Official Symbol | PNPLA3 |
| Synonyms | PNPLA3; patatin-like phospholipase domain containing 3; adiponutrin , ADPN, C22orf20, chromosome 22 open reading frame 20; patatin-like phospholipase domain-containing protein 3; adiponutrin; dJ796I17.1; FLJ22012; iPLA2-epsilon; acylglycerol O-acyltransferase; calcium-independent phospholipase A2-epsilon; ADPN; C22orf20; iPLA(2)epsilon; |
| Gene ID | 80339 |
| mRNA Refseq | NM_025225 |
| Protein Refseq | NP_079501 |
| MIM | 609567 |
| UniProt ID | Q9NST1 |
| ◆ Recombinant Proteins | ||
| Pnpla3-588M | Recombinant Mouse Pnpla3 Protein, MYC/DDK-tagged | +Inquiry |
| PNPLA3-321H | Recombinant Human PNPLA3, His-tagged | +Inquiry |
| PNPLA3-1818H | Recombinant Human PNPLA3, GST-tagged | +Inquiry |
| PNPLA3-754H | Recombinant Human PNPLA3 protein, His&Myc-tagged | +Inquiry |
| PNPLA3-15HFL | Recombinant Human PNPLA3 Protein (Full Length), N-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PNPLA3-3068HCL | Recombinant Human PNPLA3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PNPLA3 Products
Required fields are marked with *
My Review for All PNPLA3 Products
Required fields are marked with *



