Recombinant Human PNPLA7 protein, GST-tagged
Cat.No. : | PNPLA7-1887H |
Product Overview : | Recombinant Human PNPLA7 protein(302 - 468 aa), fused to GST tag, was expressed in E. coli. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 302 - 468 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MVSVASVAAGKAKKQVFYGEEERLKKPPRLQESCDSDHGGGRPAAAGPLLKRSHSVPAPSIRKQILEELEKPGAGDPDPSAPQGGPGSATSDLGMACDRARVFLHSDEHPGSSVASKSRKSVMVAEIPSTVSQHSESHTDETLASRKSDAIFRAAKKDLLTLMKLEDS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | PNPLA7 patatin-like phospholipase domain containing 7 [ Homo sapiens ] |
Official Symbol | PNPLA7 |
Synonyms | NTEL1; NTE-R1; C9orf111; RP11-48C7.2 |
Gene ID | 375775 |
mRNA Refseq | NM_152286.3 |
Protein Refseq | NP_689499.3 |
MIM | 612122 |
UniProt ID | Q6ZV29 |
◆ Recombinant Proteins | ||
PNPLA7-3860C | Recombinant Chicken PNPLA7 | +Inquiry |
PNPLA7-13046M | Recombinant Mouse PNPLA7 Protein | +Inquiry |
PNPLA7-1887H | Recombinant Human PNPLA7 protein, GST-tagged | +Inquiry |
PNPLA7-6891M | Recombinant Mouse PNPLA7 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PNPLA7 Products
Required fields are marked with *
My Review for All PNPLA7 Products
Required fields are marked with *