Recombinant Human PNPO protein, GST-tagged
Cat.No. : | PNPO-1820H |
Product Overview : | Recombinant Human PNPO protein(1-261 aa), fused with N-terminal GST tag, was expressed in E.coli. |
Availability | June 12, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-261 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | MTCWLRGVTATFGRPAEWPGYLSHLCGRSAAMDLGPMRKSYRGDREAFEETHLTSLDPVKQFAAWFEEAVQCPDIGEANAMCLATCTRDGKPSARMLLLKGFGKDGFRFFTNFESRKGKELDSNPFASLVFYWEPLNRQVRVEGPVKKLPEEEAECYFHSRPKSSQIGAVVSHQSSVIPDREYLRKKNEELEQLYQDQEVPKPKSWGGYVLYPQVMEFWQGQTNRLHDRIVFRRGLPTGDSPLGPMTHRGEEDWLYERLAP |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | PNPO pyridoxamine 5-phosphate oxidase [ Homo sapiens ] |
Official Symbol | PNPO |
Synonyms | PNPO; pyridoxamine 5-phosphate oxidase; pyridoxine 5 phosphate oxidase; pyridoxine-5-phosphate oxidase; PDXPO; pyridoxamine-phosphate oxidase; pyridoxal 5-phosphate synthase; pyridoxine 5-phosphate oxidase; FLJ10535; |
Gene ID | 55163 |
mRNA Refseq | NM_018129 |
Protein Refseq | NP_060599 |
MIM | 603287 |
UniProt ID | Q9NVS9 |
◆ Recombinant Proteins | ||
PNPO-1820H | Recombinant Human PNPO protein, GST-tagged | +Inquiry |
PNPO-4553R | Recombinant Rat PNPO Protein | +Inquiry |
PNPO-8118Z | Recombinant Zebrafish PNPO | +Inquiry |
PNPO-27512TH | Recombinant Human PNPO, His-tagged | +Inquiry |
PNPO-3315R | Recombinant Rhesus Macaque PNPO Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PNPO-3065HCL | Recombinant Human PNPO 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PNPO Products
Required fields are marked with *
My Review for All PNPO Products
Required fields are marked with *
0
Inquiry Basket