Recombinant Human POLA1 protein, His-tagged
Cat.No. : | POLA1-2944H |
Product Overview : | Recombinant Human POLA1 protein(1-217 aa), fused to His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-217 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MAPVHGDDSLSDSGSFVSSRARREKKSKKGRQEALERLKKAKAGEKYKYEVEDFTGVYEEVDEEQYSKLVQARQDDDWIVDDDGIGYVEDGREIFDDDLEDDALDADEKGKDGKARNKDKRNVKKLAVTKPNNIKSMFIACAGKKTADKAVDLSKDGLLGDILQDLNTETPQITPPPVMILKKKRSIGASPNPFSVHTATAVPSGKIASPVSRKEPP |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | POLA1 polymerase (DNA directed), alpha 1, catalytic subunit [ Homo sapiens ] |
Official Symbol | POLA1 |
Synonyms | POLA1; polymerase (DNA directed), alpha 1, catalytic subunit; POLA, polymerase (DNA directed), alpha , polymerase (DNA directed), alpha 1; DNA polymerase alpha catalytic subunit; p180; DNA polymerase alpha p180 subunit; polymerase (DNA-directed), alpha (70kD); DNA polymerase alpha 1 catalytic subunit; DNA polymerase alpha catalytic subunit p180; POLA; DKFZp686K1672; |
Gene ID | 5422 |
mRNA Refseq | NM_016937 |
Protein Refseq | NP_058633 |
MIM | 312040 |
UniProt ID | P09884 |
◆ Recombinant Proteins | ||
Pola1-8021M | Recombinant Mouse Pola1 protein, His & T7-tagged | +Inquiry |
POLA1-2944H | Recombinant Human POLA1 protein, His-tagged | +Inquiry |
POLA-938H | Recombinant Human POLA1 protein | +Inquiry |
POLA1-4560R | Recombinant Rat POLA1 Protein | +Inquiry |
POLA1-28359TH | Recombinant Human POLA1 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All POLA1 Products
Required fields are marked with *
My Review for All POLA1 Products
Required fields are marked with *
0
Inquiry Basket