Recombinant Human POLA1 protein, His-tagged

Cat.No. : POLA1-2944H
Product Overview : Recombinant Human POLA1 protein(1-217 aa), fused to His tag, was expressed in E. coli.
Availability June 12, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-217 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : MAPVHGDDSLSDSGSFVSSRARREKKSKKGRQEALERLKKAKAGEKYKYEVEDFTGVYEEVDEEQYSKLVQARQDDDWIVDDDGIGYVEDGREIFDDDLEDDALDADEKGKDGKARNKDKRNVKKLAVTKPNNIKSMFIACAGKKTADKAVDLSKDGLLGDILQDLNTETPQITPPPVMILKKKRSIGASPNPFSVHTATAVPSGKIASPVSRKEPP
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name POLA1 polymerase (DNA directed), alpha 1, catalytic subunit [ Homo sapiens ]
Official Symbol POLA1
Synonyms POLA1; polymerase (DNA directed), alpha 1, catalytic subunit; POLA, polymerase (DNA directed), alpha , polymerase (DNA directed), alpha 1; DNA polymerase alpha catalytic subunit; p180; DNA polymerase alpha p180 subunit; polymerase (DNA-directed), alpha (70kD); DNA polymerase alpha 1 catalytic subunit; DNA polymerase alpha catalytic subunit p180; POLA; DKFZp686K1672;
Gene ID 5422
mRNA Refseq NM_016937
Protein Refseq NP_058633
MIM 312040
UniProt ID P09884

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All POLA1 Products

Required fields are marked with *

My Review for All POLA1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon