Recombinant Human POLD1, His-tagged
| Cat.No. : | POLD1-28360TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 929-1102 of Human DNA Polymerase delta, catalytic subunit with an N terminal His tag. Predicted MWt: 21 kDa; |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 929-1102 a.a. |
| Description : | The DNA polymerase delta complex is involved in DNA replication and repair, and it consists of the proliferating cell nuclear antigen (PCNA; MIM 176740), the multisubunit replication factor C (see MIM 102579), and the 4 subunit polymerase complex: POLD1, POLD2 (MIM 600815), POLD3 (MIM 611415), and POLD4 (MIM 611525) (Liu and Warbrick, 2006 |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 89 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | AAKGVAAYMKSEDPLFVLEHSLPIDTQYYLEQQLAKPLLR IFEPILGEGRAEAVLLRGDHTRCKTVLTGKVGGLLAFA KRRNCCIGCRTVLSHQGAVCEFCQPRESELYQKEVSHL NALEERFSRLWTQCQRCQGSLHEDVICTSRDCPIFYMR KKVRKDLEDQEQLLRRFGPP |
| Sequence Similarities : | Belongs to the DNA polymerase type-B family. |
| Gene Name | POLD1 polymerase (DNA directed), delta 1, catalytic subunit 125kDa [ Homo sapiens ] |
| Official Symbol | POLD1 |
| Synonyms | POLD1; polymerase (DNA directed), delta 1, catalytic subunit 125kDa; POLD, polymerase (DNA directed), delta 1, catalytic subunit (125kD); DNA polymerase delta catalytic subunit; CDC2; CDC2 homolog (S. cerevisiae); |
| Gene ID | 5424 |
| mRNA Refseq | NM_002691 |
| Protein Refseq | NP_002682 |
| MIM | 174761 |
| Uniprot ID | P28340 |
| Chromosome Location | 19q13.3 |
| Pathway | Base Excision Repair, organism-specific biosystem; Base excision repair, organism-specific biosystem; Base excision repair, conserved biosystem; Cell Cycle, Mitotic, organism-specific biosystem; Chromosome Maintenance, organism-specific biosystem; |
| Function | 3-5-exodeoxyribonuclease activity; DNA binding; DNA-directed DNA polymerase activity; chromatin binding; hydrolase activity; |
| ◆ Recombinant Proteins | ||
| POLD1-6904M | Recombinant Mouse POLD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| POLD1-3654Z | Recombinant Zebrafish POLD1 | +Inquiry |
| POLD1-4562R | Recombinant Rat POLD1 Protein | +Inquiry |
| Pold1-1958M | Recombinant Mouse Pold1 Protein, His-tagged | +Inquiry |
| POLD1-4222R | Recombinant Rat POLD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| POLD1-3053HCL | Recombinant Human POLD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All POLD1 Products
Required fields are marked with *
My Review for All POLD1 Products
Required fields are marked with *
