Recombinant Human POLD2 Protein, His-tagged

Cat.No. : POLD2-111H
Product Overview : Recombinant Human POLD2, transcript variant 2, fused with His tag at C-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : This gene encodes the 50-kDa catalytic subunit of DNA polymerase delta. DNA polymerase delta possesses both polymerase and 3' to 5' exonuclease activity and plays a critical role in DNA replication and repair. The encoded protein is required for the stimulation of DNA polymerase delta activity by the processivity cofactor proliferating cell nuclear antigen (PCNA). Expression of this gene may be a marker for ovarian carcinomas. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 5.
Form : Supplied as a 0.2 µM filtered solution of PBS, 10% Glycerol, pH 7.4
Molecular Mass : 52.3kD
AA Sequence : MFSEQAAQRAHTLLSPPSANNATFARVPVATYTNSSQPFRLGERSFSRQYAHIYATRLIQMRPFLENRAQQHWGSGVGVKKLCELQPEEKCCVVGTLFKAMPLQPSILREVSEEHNLLPQPPRSKYIHPDDELVLEDELQRIKLKGTIDVSKLVTGTVLAVFGSVRDDGKFLVEDYCFADLAPQKPAPPLDTDRFVLLVSGLGLGGGGGESLLGTQLLVDVVTGQLGDEGEQCSAAHVSRVILAGNLLSHSTQSR
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Gene Name POLD2 polymerase (DNA directed), delta 2, regulatory subunit 50kDa [ Homo sapiens ]
Official Symbol POLD2
Synonyms POLD2; polymerase (DNA directed), delta 2, regulatory subunit 50kDa; polymerase (DNA directed), delta 2, regulatory subunit (50kD); DNA polymerase delta subunit 2; DNA polymerase delta subunit p50;
Gene ID 5425
mRNA Refseq NM_006230
Protein Refseq NP_006221
MIM 600815
UniProt ID P49005

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All POLD2 Products

Required fields are marked with *

My Review for All POLD2 Products

Required fields are marked with *

0
cart-icon