Recombinant Human POLR2E Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : POLR2E-2514H
Product Overview : POLR2E MS Standard C13 and N15-labeled recombinant protein (NP_002686) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes the fifth largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This subunit is shared by the other two DNA-directed RNA polymerases and is present in two-fold molar excess over the other polymerase subunits. An interaction between this subunit and a hepatitis virus transactivating protein has been demonstrated, suggesting that interaction between transcriptional activators and the polymerase can occur through this subunit. A pseudogene is located on chromosome 11. Three transcript variants encoding two different isoforms have been found for this gene.
Molecular Mass : 24.6 kDa
AA Sequence : MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLVQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name POLR2E RNA polymerase II, I and III subunit E [ Homo sapiens (human) ]
Official Symbol POLR2E
Synonyms POLR2E; polymerase (RNA) II (DNA directed) polypeptide E, 25kDa; polymerase (RNA) II (DNA directed) polypeptide E (25kD); DNA-directed RNA polymerases I, II, and III subunit RPABC1; DNA directed RNA polymerase II 23 kda polypeptide; hRPB25; hsRPB5; RPABC1; RPB5; XAP4; RPB5 homolog; DNA-directed RNA polymerase II subunit E; RNA polymerases I, II, and III subunit ABC1; DNA-directed RNA polymerase II 23 kDa polypeptide;
Gene ID 5434
mRNA Refseq NM_002695
Protein Refseq NP_002686
MIM 180664
UniProt ID P19388

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All POLR2E Products

Required fields are marked with *

My Review for All POLR2E Products

Required fields are marked with *

0
cart-icon
0
compare icon