Recombinant Human POLR2E Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | POLR2E-2514H |
| Product Overview : | POLR2E MS Standard C13 and N15-labeled recombinant protein (NP_002686) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes the fifth largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This subunit is shared by the other two DNA-directed RNA polymerases and is present in two-fold molar excess over the other polymerase subunits. An interaction between this subunit and a hepatitis virus transactivating protein has been demonstrated, suggesting that interaction between transcriptional activators and the polymerase can occur through this subunit. A pseudogene is located on chromosome 11. Three transcript variants encoding two different isoforms have been found for this gene. |
| Molecular Mass : | 24.6 kDa |
| AA Sequence : | MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTVLVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLVQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | POLR2E RNA polymerase II, I and III subunit E [ Homo sapiens (human) ] |
| Official Symbol | POLR2E |
| Synonyms | POLR2E; polymerase (RNA) II (DNA directed) polypeptide E, 25kDa; polymerase (RNA) II (DNA directed) polypeptide E (25kD); DNA-directed RNA polymerases I, II, and III subunit RPABC1; DNA directed RNA polymerase II 23 kda polypeptide; hRPB25; hsRPB5; RPABC1; RPB5; XAP4; RPB5 homolog; DNA-directed RNA polymerase II subunit E; RNA polymerases I, II, and III subunit ABC1; DNA-directed RNA polymerase II 23 kDa polypeptide; |
| Gene ID | 5434 |
| mRNA Refseq | NM_002695 |
| Protein Refseq | NP_002686 |
| MIM | 180664 |
| UniProt ID | P19388 |
| ◆ Recombinant Proteins | ||
| POLR2E-1843H | Recombinant Human POLR2E, GST-tagged | +Inquiry |
| POLR2E-521H | Recombinant Human POLR2E | +Inquiry |
| POLR2E-4229R | Recombinant Rat POLR2E Protein, His (Fc)-Avi-tagged | +Inquiry |
| POLR2E-4569R | Recombinant Rat POLR2E Protein | +Inquiry |
| Polr2e-4997M | Recombinant Mouse Polr2e Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| POLR2E-3034HCL | Recombinant Human POLR2E 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All POLR2E Products
Required fields are marked with *
My Review for All POLR2E Products
Required fields are marked with *
