Recombinant Human POLR2F protein, GST-tagged
Cat.No. : | POLR2F-1844H |
Product Overview : | Recombinant Human POLR2F protein(1-127 aa), fused with N-terminal GST tag, was expressed in E. coli. |
Availability | July 06, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-127 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIITD |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | POLR2F |
Synonyms | POLR2F; polymerase (RNA) II (DNA directed) polypeptide F; DNA-directed RNA polymerases I, II, and III subunit RPABC2; DNA directed RNA polymerase II 14.4 kda polypeptide; HRBP14.4; RPB6; RPC15; RPABC14.4; RPB6 homolog; RNA Polymerase II subunit 14.4 kD; DNA-directed RNA polymerase II subunit F; RNA polymerases I, II, and III subunit ABC2; DNA-directed RNA polymerases I, II, and III 14.4 kDa polypeptide; POLRF; RPABC2; RPB14.4; |
Gene ID | 5435 |
mRNA Refseq | NM_021974 |
Protein Refseq | NP_068809 |
MIM | 604414 |
UniProt ID | P61218 |
◆ Recombinant Proteins | ||
POLR2F-3516R | Recombinant Rhesus monkey POLR2F Protein, His-tagged | +Inquiry |
POLR2F-666Z | Recombinant Zebrafish POLR2F | +Inquiry |
POLR2F-4570R | Recombinant Rat POLR2F Protein | +Inquiry |
POLR2F-6923M | Recombinant Mouse POLR2F Protein, His (Fc)-Avi-tagged | +Inquiry |
POLR2F-3334R | Recombinant Rhesus Macaque POLR2F Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
POLR2F-3033HCL | Recombinant Human POLR2F 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All POLR2F Products
Required fields are marked with *
My Review for All POLR2F Products
Required fields are marked with *