Recombinant Human POLR2F protein, GST-tagged

• Cat.No.: POLR2F-1844H
• Product Overview: Recombinant Human POLR2F protein(1-127 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-127 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• AA Sequence: MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIITD
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Gene Information

• Official Symbol: POLR2F
• Synonyms: POLR2F; polymerase (RNA) II (DNA directed) polypeptide F; DNA-directed RNA polymerases I, II, and III subunit RPABC2; DNA directed RNA polymerase II 14.4 kda polypeptide; HRBP14.4; RPB6; RPC15; RPABC14.4; RPB6 homolog; RNA Polymerase II subunit 14.4 kD; DNA-directed RNA polymerase II subunit F; RNA polymerases I, II, and III subunit ABC2; DNA-directed RNA polymerases I, II, and III 14.4 kDa polypeptide; POLRF; RPABC2; RPB14.4
• Gene ID: 5435
• mRNA Refseq: NM_021974
• Protein Refseq: NP_068809
• MIM: 604414
• UniProt ID: P61218