Recombinant Human POLR2F Protein, MYC/DDK-tagged, C13 and N15-labeled
| Cat.No. : | POLR2F-374H |
| Product Overview : | POLR2F MS Standard C13 and N15-labeled recombinant protein (NP_068809) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes the sixth largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. In yeast, this polymerase subunit, in combination with at least two other subunits, forms a structure that stabilizes the transcribing polymerase on the DNA template. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014] |
| Molecular Mass : | 14.5 kDa |
| AA Sequence : | MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIITDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | POLR2F polymerase (RNA) II (DNA directed) polypeptide F [ Homo sapiens (human) ] |
| Official Symbol | POLR2F |
| Synonyms | POLR2F; polymerase (RNA) II (DNA directed) polypeptide F; DNA-directed RNA polymerases I, II, and III subunit RPABC2; DNA directed RNA polymerase II 14.4 kda polypeptide; HRBP14.4; RPB6; RPC15; RPABC14.4; RPB6 homolog; RNA Polymerase II subunit 14.4 kD; DNA-directed RNA polymerase II subunit F; RNA polymerases I, II, and III subunit ABC2; DNA-directed RNA polymerases I, II, and III 14.4 kDa polypeptide; POLRF; RPABC2; RPB14.4; |
| Gene ID | 5435 |
| mRNA Refseq | NM_021974 |
| Protein Refseq | NP_068809 |
| MIM | 604414 |
| UniProt ID | P61218 |
| ◆ Recombinant Proteins | ||
| POLR2F-4230R | Recombinant Rat POLR2F Protein, His (Fc)-Avi-tagged | +Inquiry |
| POLR2F-374H | Recombinant Human POLR2F Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| POLR2F-3334R | Recombinant Rhesus Macaque POLR2F Protein, His (Fc)-Avi-tagged | +Inquiry |
| POLR2F-13096M | Recombinant Mouse POLR2F Protein | +Inquiry |
| POLR2F-30687TH | Recombinant Human POLR2F | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| POLR2F-3033HCL | Recombinant Human POLR2F 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All POLR2F Products
Required fields are marked with *
My Review for All POLR2F Products
Required fields are marked with *
