Recombinant Human POLR2F Protein, MYC/DDK-tagged, C13 and N15-labeled

Cat.No. : POLR2F-374H
Product Overview : POLR2F MS Standard C13 and N15-labeled recombinant protein (NP_068809) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes the sixth largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. In yeast, this polymerase subunit, in combination with at least two other subunits, forms a structure that stabilizes the transcribing polymerase on the DNA template. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]
Molecular Mass : 14.5 kDa
AA Sequence : MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIITDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name POLR2F polymerase (RNA) II (DNA directed) polypeptide F [ Homo sapiens (human) ]
Official Symbol POLR2F
Synonyms POLR2F; polymerase (RNA) II (DNA directed) polypeptide F; DNA-directed RNA polymerases I, II, and III subunit RPABC2; DNA directed RNA polymerase II 14.4 kda polypeptide; HRBP14.4; RPB6; RPC15; RPABC14.4; RPB6 homolog; RNA Polymerase II subunit 14.4 kD; DNA-directed RNA polymerase II subunit F; RNA polymerases I, II, and III subunit ABC2; DNA-directed RNA polymerases I, II, and III 14.4 kDa polypeptide; POLRF; RPABC2; RPB14.4;
Gene ID 5435
mRNA Refseq NM_021974
Protein Refseq NP_068809
MIM 604414
UniProt ID P61218

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All POLR2F Products

Required fields are marked with *

My Review for All POLR2F Products

Required fields are marked with *

0
cart-icon