Recombinant Human POLR2H Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: POLR2H-914H
• Product Overview: POLR2H MS Standard C13 and N15-labeled recombinant protein (NP_006223) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The three eukaryotic RNA polymerases are complex multisubunit enzymes that play a central role in the transcription of nuclear genes. This gene encodes an essential and highly conserved subunit of RNA polymerase II that is shared by the other two eukaryotic DNA-directed RNA polymerases, I and III. Alternative splicing results in multiple transcript variants of this gene.
• Molecular Mass: 17.1 kDa
• AA Sequence: MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: POLR2H RNA polymerase II, I and III subunit H [ Homo sapiens (human) ]
• Official Symbol: POLR2H
• Synonyms: POLR2H; polymerase (RNA) II (DNA directed) polypeptide H; DNA-directed RNA polymerases I, II, and III subunit RPABC3; RPB8; hRPB8; RPB8 homolog; DNA-directed RNA polymerase II subunit H; RNA polymerases I, II, and III subunit ABC3; DNA-directed RNA polymerases I, II, and III 17.1 kDa polypeptide; RPB17; RPABC3; hsRPB8
• Gene ID: 5437
• mRNA Refseq: NM_006232
• Protein Refseq: NP_006223
• MIM: 606023
• UniProt ID: P52434