Recombinant Human POLR2H Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : POLR2H-914H
Product Overview : POLR2H MS Standard C13 and N15-labeled recombinant protein (NP_006223) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The three eukaryotic RNA polymerases are complex multisubunit enzymes that play a central role in the transcription of nuclear genes. This gene encodes an essential and highly conserved subunit of RNA polymerase II that is shared by the other two eukaryotic DNA-directed RNA polymerases, I and III. Alternative splicing results in multiple transcript variants of this gene.
Molecular Mass : 17.1 kDa
AA Sequence : MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name POLR2H RNA polymerase II, I and III subunit H [ Homo sapiens (human) ]
Official Symbol POLR2H
Synonyms POLR2H; polymerase (RNA) II (DNA directed) polypeptide H; DNA-directed RNA polymerases I, II, and III subunit RPABC3; RPB8; hRPB8; RPB8 homolog; DNA-directed RNA polymerase II subunit H; RNA polymerases I, II, and III subunit ABC3; DNA-directed RNA polymerases I, II, and III 17.1 kDa polypeptide; RPB17; RPABC3; hsRPB8;
Gene ID 5437
mRNA Refseq NM_006232
Protein Refseq NP_006223
MIM 606023
UniProt ID P52434

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All POLR2H Products

Required fields are marked with *

My Review for All POLR2H Products

Required fields are marked with *

0

Inquiry Basket

cartIcon