Recombinant Human POLR2H Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | POLR2H-914H |
| Product Overview : | POLR2H MS Standard C13 and N15-labeled recombinant protein (NP_006223) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | The three eukaryotic RNA polymerases are complex multisubunit enzymes that play a central role in the transcription of nuclear genes. This gene encodes an essential and highly conserved subunit of RNA polymerase II that is shared by the other two eukaryotic DNA-directed RNA polymerases, I and III. Alternative splicing results in multiple transcript variants of this gene. |
| Molecular Mass : | 17.1 kDa |
| AA Sequence : | MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | POLR2H RNA polymerase II, I and III subunit H [ Homo sapiens (human) ] |
| Official Symbol | POLR2H |
| Synonyms | POLR2H; polymerase (RNA) II (DNA directed) polypeptide H; DNA-directed RNA polymerases I, II, and III subunit RPABC3; RPB8; hRPB8; RPB8 homolog; DNA-directed RNA polymerase II subunit H; RNA polymerases I, II, and III subunit ABC3; DNA-directed RNA polymerases I, II, and III 17.1 kDa polypeptide; RPB17; RPABC3; hsRPB8; |
| Gene ID | 5437 |
| mRNA Refseq | NM_006232 |
| Protein Refseq | NP_006223 |
| MIM | 606023 |
| UniProt ID | P52434 |
| ◆ Recombinant Proteins | ||
| POLR2H-544C | Recombinant Cynomolgus Monkey POLR2H Protein, His (Fc)-Avi-tagged | +Inquiry |
| POLR2H-1846H | Recombinant Human POLR2H, GST-tagged | +Inquiry |
| POLR2H-13098M | Recombinant Mouse POLR2H Protein | +Inquiry |
| POLR2H-8509H | Recombinant Human POLR2H, GST-tagged | +Inquiry |
| POLR2H-6925M | Recombinant Mouse POLR2H Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| POLR2H-3031HCL | Recombinant Human POLR2H 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All POLR2H Products
Required fields are marked with *
My Review for All POLR2H Products
Required fields are marked with *




