Recombinant Human POLR2J Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | POLR2J-801H |
Product Overview : | POLR2J MS Standard C13 and N15-labeled recombinant protein (NP_006225) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. The product of this gene exists as a heterodimer with another polymerase subunit; together they form a core subassembly unit of the polymerase. Two similar genes are located nearby on chromosome 7q22.1 and a pseudogene is found on chromosome 7p13. |
Molecular Mass : | 13.3 kDa |
AA Sequence : | MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | POLR2J RNA polymerase II subunit J [ Homo sapiens (human) ] |
Official Symbol | POLR2J |
Synonyms | POLR2J; polymerase (RNA) II (DNA directed) polypeptide J, 13.3kDa; polymerase (RNA) II (DNA directed) polypeptide J (13.3kD); DNA-directed RNA polymerase II subunit RPB11-a; hRPB14; POLR2J1; RPB11; RPB11A; RPB11m; RNA polymerase II subunit B11-a; RNA polymerase II 13.3 kDa subunit; DNA-directed RNA polymerase II subunit J-1; MGC71910; |
Gene ID | 5439 |
mRNA Refseq | NM_006234 |
Protein Refseq | NP_006225 |
MIM | 604150 |
UniProt ID | P52435 |
◆ Recombinant Proteins | ||
POLR2J-7206H | Recombinant Human Polymerase (RNA) II (DNA Directed) Polypeptide J, 13.3kDa, His-tagged | +Inquiry |
POLR2J-3005Z | Recombinant Zebrafish POLR2J | +Inquiry |
Polr2j-5000M | Recombinant Mouse Polr2j Protein, Myc/DDK-tagged | +Inquiry |
POLR2J-801H | Recombinant Human POLR2J Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
POLR2J-1848H | Recombinant Human POLR2J, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
POLR2J-3030HCL | Recombinant Human POLR2J 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All POLR2J Products
Required fields are marked with *
My Review for All POLR2J Products
Required fields are marked with *