Recombinant Human POLR2J Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : POLR2J-801H
Product Overview : POLR2J MS Standard C13 and N15-labeled recombinant protein (NP_006225) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. The product of this gene exists as a heterodimer with another polymerase subunit; together they form a core subassembly unit of the polymerase. Two similar genes are located nearby on chromosome 7q22.1 and a pseudogene is found on chromosome 7p13.
Molecular Mass : 13.3 kDa
AA Sequence : MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIETRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name POLR2J RNA polymerase II subunit J [ Homo sapiens (human) ]
Official Symbol POLR2J
Synonyms POLR2J; polymerase (RNA) II (DNA directed) polypeptide J, 13.3kDa; polymerase (RNA) II (DNA directed) polypeptide J (13.3kD); DNA-directed RNA polymerase II subunit RPB11-a; hRPB14; POLR2J1; RPB11; RPB11A; RPB11m; RNA polymerase II subunit B11-a; RNA polymerase II 13.3 kDa subunit; DNA-directed RNA polymerase II subunit J-1; MGC71910;
Gene ID 5439
mRNA Refseq NM_006234
Protein Refseq NP_006225
MIM 604150
UniProt ID P52435

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All POLR2J Products

Required fields are marked with *

My Review for All POLR2J Products

Required fields are marked with *

0
cart-icon