Recombinant Human POLR2J2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | POLR2J2-6498H |
Product Overview : | POLR2J2 MS Standard C13 and N15-labeled recombinant protein (NP_116581) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene is a member of the RNA polymerase II subunit 11 gene family, which includes three genes in a cluster on chromosome 7q22.1 and a pseudogene on chromosome 7p13. The founding member of this family, DNA directed RNA polymerase II polypeptide J, has been shown to encode a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This locus produces multiple, alternatively spliced transcripts that potentially express isoforms with distinct C-termini compared to DNA directed RNA polymerase II polypeptide J. Most or all variants are spliced to include additional non-coding exons at the 3' end which makes them candidates for nonsense-mediated decay (NMD). Consequently, it is not known if this locus expresses a protein or proteins in vivo. |
Molecular Mass : | 12.9 kDa |
AA Sequence : | MNAPPAFESFLLFEGEKITINKDTKVPNACLFTMNKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRTCLLPLRLLPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | POLR2J2 RNA polymerase II subunit J2 [ Homo sapiens (human) ] |
Official Symbol | POLR2J2 |
Synonyms | POLR2J2; polymerase (RNA) II (DNA directed) polypeptide J2; DNA-directed RNA polymerase II subunit RPB11-b1; RPB11b1; RNA polymerase II subunit B11-b1; DNA-directed RNA polymerase II subunit J2; DNA directed RNA polymerase II polypeptide J-related; HRPB11B; MGC54043; MGC105050; |
Gene ID | 246721 |
mRNA Refseq | NM_032959 |
Protein Refseq | NP_116581 |
MIM | 609881 |
UniProt ID | Q9GZM3 |
◆ Recombinant Proteins | ||
POLR2J2-6498H | Recombinant Human POLR2J2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
POLR2J2-321H | Recombinant Human POLR2J2 Protein, His-tagged | +Inquiry |
POLR2J2-3533H | Recombinant Human POLR2J2 protein, GST-tagged | +Inquiry |
POLR2J2-7252H | Recombinant Human POLR2J2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
POLR2J2-3029HCL | Recombinant Human POLR2J2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All POLR2J2 Products
Required fields are marked with *
My Review for All POLR2J2 Products
Required fields are marked with *