Recombinant Human POLR3K protein, His-SUMO-tagged
| Cat.No. : | POLR3K-3355H |
| Product Overview : | Recombinant Human POLR3K protein(Q9Y2Y1)(1-108aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-108aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 28.3 kDa |
| AA Sequence : | MLLFCPGCGNGLIVEEGQRCHRFSCNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | POLR3K polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa [ Homo sapiens ] |
| Official Symbol | POLR3K |
| Synonyms | POLR3K; polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa; polymerase (RNA) III (DNA directed) polypeptide K (12.3 kDa); DNA-directed RNA polymerase III subunit RPC10; RPC11; RNA polymerase III subunit C10; RNA polymerase III subunit C11; RNA polymerase III subunit CII; RNA polymerase III 12.5 kDa subunit; RNA polymerase III subunit (hRPC11); DNA-directed RNA polymerase III subunit K; DNA-directed RNA polymerases III 12.5 kDa polypeptide; C11; My010; RPC10; hRPC11; RPC12.5; C11-RNP3; |
| Gene ID | 51728 |
| mRNA Refseq | NM_016310 |
| Protein Refseq | NP_057394 |
| MIM | 606007 |
| UniProt ID | Q9Y2Y1 |
| ◆ Recombinant Proteins | ||
| POLR3K-266H | Recombinant Human POLR3K, His-tagged | +Inquiry |
| POLR3K-1852H | Recombinant Human POLR3K, GST-tagged | +Inquiry |
| POLR3K-4756H | Recombinant Human POLR3K protein, His-tagged | +Inquiry |
| POLR3K-7996H | Recombinant Human POLR3K protein | +Inquiry |
| Polr3k-5009M | Recombinant Mouse Polr3k Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| POLR3K-3020HCL | Recombinant Human POLR3K 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All POLR3K Products
Required fields are marked with *
My Review for All POLR3K Products
Required fields are marked with *
