Recombinant Human POLR3K protein, His-SUMO-tagged

Cat.No. : POLR3K-3355H
Product Overview : Recombinant Human POLR3K protein(Q9Y2Y1)(1-108aa), fused to N-terminal His-SUMO tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 1-108aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 28.3 kDa
AA Sequence : MLLFCPGCGNGLIVEEGQRCHRFSCNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name POLR3K polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa [ Homo sapiens ]
Official Symbol POLR3K
Synonyms POLR3K; polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa; polymerase (RNA) III (DNA directed) polypeptide K (12.3 kDa); DNA-directed RNA polymerase III subunit RPC10; RPC11; RNA polymerase III subunit C10; RNA polymerase III subunit C11; RNA polymerase III subunit CII; RNA polymerase III 12.5 kDa subunit; RNA polymerase III subunit (hRPC11); DNA-directed RNA polymerase III subunit K; DNA-directed RNA polymerases III 12.5 kDa polypeptide; C11; My010; RPC10; hRPC11; RPC12.5; C11-RNP3;
Gene ID 51728
mRNA Refseq NM_016310
Protein Refseq NP_057394
MIM 606007
UniProt ID Q9Y2Y1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All POLR3K Products

Required fields are marked with *

My Review for All POLR3K Products

Required fields are marked with *

0
cart-icon