Recombinant Human POLR3K protein, His-tagged

Cat.No. : POLR3K-4756H
Product Overview : Recombinant Human POLR3K protein(Q9Y2Y1)(1-108aa), fused with C-terminal His tag, was expressed in Insect cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect cells
Tag : His
Protein Length : 1-108aa
Tag : C-His
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 15.1 kDa
Purity : Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SEC-HPLC.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD
Gene Name POLR3K polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa [ Homo sapiens ]
Official Symbol POLR3K
Synonyms POLR3K; polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa; polymerase (RNA) III (DNA directed) polypeptide K (12.3 kDa); DNA-directed RNA polymerase III subunit RPC10; RPC11; RNA polymerase III subunit C10; RNA polymerase III subunit C11; RNA polymerase III subunit CII; RNA polymerase III 12.5 kDa subunit; RNA polymerase III subunit (hRPC11); DNA-directed RNA polymerase III subunit K; DNA-directed RNA polymerases III 12.5 kDa polypeptide; C11; My010; RPC10; hRPC11; RPC12.5; C11-RNP3;
Gene ID 51728
mRNA Refseq NM_016310
Protein Refseq NP_057394
MIM 606007
UniProt ID Q9Y2Y1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All POLR3K Products

Required fields are marked with *

My Review for All POLR3K Products

Required fields are marked with *

0
cart-icon
0
compare icon