Recombinant Human POLR3K protein, His-tagged
Cat.No. : | POLR3K-4756H |
Product Overview : | Recombinant Human POLR3K protein(Q9Y2Y1)(1-108aa), fused with C-terminal His tag, was expressed in Insect cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect cells |
Tag : | His |
Protein Length : | 1-108aa |
Tag : | C-His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 15.1 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. Greater than 90% as determined by SEC-HPLC. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD |
Gene Name | POLR3K polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa [ Homo sapiens ] |
Official Symbol | POLR3K |
Synonyms | POLR3K; polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa; polymerase (RNA) III (DNA directed) polypeptide K (12.3 kDa); DNA-directed RNA polymerase III subunit RPC10; RPC11; RNA polymerase III subunit C10; RNA polymerase III subunit C11; RNA polymerase III subunit CII; RNA polymerase III 12.5 kDa subunit; RNA polymerase III subunit (hRPC11); DNA-directed RNA polymerase III subunit K; DNA-directed RNA polymerases III 12.5 kDa polypeptide; C11; My010; RPC10; hRPC11; RPC12.5; C11-RNP3; |
Gene ID | 51728 |
mRNA Refseq | NM_016310 |
Protein Refseq | NP_057394 |
MIM | 606007 |
UniProt ID | Q9Y2Y1 |
◆ Recombinant Proteins | ||
POLR3K-1482H | Recombinant Human POLR3K Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
POLR3K-674Z | Recombinant Zebrafish POLR3K | +Inquiry |
Polr3k-5009M | Recombinant Mouse Polr3k Protein, Myc/DDK-tagged | +Inquiry |
POLR3K-3355H | Recombinant Human POLR3K protein, His-SUMO-tagged | +Inquiry |
POLR3K-4756H | Recombinant Human POLR3K protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
POLR3K-3020HCL | Recombinant Human POLR3K 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All POLR3K Products
Required fields are marked with *
My Review for All POLR3K Products
Required fields are marked with *