Recombinant Human POMP Protein, GST-tagged

Cat.No. : POMP-521H
Product Overview : Human C13orf12 full-length ORF ( NP_057016.1, 1 a.a. - 141 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 42.2 kDa
AA Sequence : MNARGLGSELKDSIPVTELSASGPFESHDLLRKGFSCVKNELLPSHPLELSEKNFQLNQDKMNFSTLRNIQGLFAPLKLQMEFKAVQQVQRLPFLSSSNLSLDVLRGNDETIGFEDILNDPSQSEVMGEPHLMVEYKLGLL
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name POMP proteasome maturation protein [ Homo sapiens ]
Official Symbol POMP
Synonyms POMP; proteasome maturation protein; C13orf12, chromosome 13 open reading frame 12; HSPC014; proteassemblin; UMP1; hUMP1; 2510048O06Rik; protein UMP1 homolog; voltage-gated K channel beta subunit 4.1; voltage-gated potassium channel beta subunit 4.1; C13orf12; PNAS-110;
Gene ID 51371
mRNA Refseq NM_015932
Protein Refseq NP_057016
MIM 613386
UniProt ID Q9Y244

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All POMP Products

Required fields are marked with *

My Review for All POMP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon