Recombinant Human POMP Protein, GST-tagged
| Cat.No. : | POMP-521H |
| Product Overview : | Human C13orf12 full-length ORF ( NP_057016.1, 1 a.a. - 141 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 42.2 kDa |
| AA Sequence : | MNARGLGSELKDSIPVTELSASGPFESHDLLRKGFSCVKNELLPSHPLELSEKNFQLNQDKMNFSTLRNIQGLFAPLKLQMEFKAVQQVQRLPFLSSSNLSLDVLRGNDETIGFEDILNDPSQSEVMGEPHLMVEYKLGLL |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | POMP proteasome maturation protein [ Homo sapiens ] |
| Official Symbol | POMP |
| Synonyms | POMP; proteasome maturation protein; C13orf12, chromosome 13 open reading frame 12; HSPC014; proteassemblin; UMP1; hUMP1; 2510048O06Rik; protein UMP1 homolog; voltage-gated K channel beta subunit 4.1; voltage-gated potassium channel beta subunit 4.1; C13orf12; PNAS-110; |
| Gene ID | 51371 |
| mRNA Refseq | NM_015932 |
| Protein Refseq | NP_057016 |
| MIM | 613386 |
| UniProt ID | Q9Y244 |
| ◆ Recombinant Proteins | ||
| POMP-2275H | Recombinant Human POMP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| POMP-3524R | Recombinant Rhesus monkey POMP Protein, His-tagged | +Inquiry |
| POMP-1771HF | Recombinant Full Length Human POMP Protein, GST-tagged | +Inquiry |
| Pomp-5012M | Recombinant Mouse Pomp Protein, Myc/DDK-tagged | +Inquiry |
| POMP-4834H | Recombinant Human POMP Protein (Met1-Leu141), N-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| POMP-3017HCL | Recombinant Human POMP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All POMP Products
Required fields are marked with *
My Review for All POMP Products
Required fields are marked with *
