Recombinant Human POMP Protein, GST-tagged
Cat.No. : | POMP-521H |
Product Overview : | Human C13orf12 full-length ORF ( NP_057016.1, 1 a.a. - 141 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 42.2 kDa |
AA Sequence : | MNARGLGSELKDSIPVTELSASGPFESHDLLRKGFSCVKNELLPSHPLELSEKNFQLNQDKMNFSTLRNIQGLFAPLKLQMEFKAVQQVQRLPFLSSSNLSLDVLRGNDETIGFEDILNDPSQSEVMGEPHLMVEYKLGLL |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | POMP proteasome maturation protein [ Homo sapiens ] |
Official Symbol | POMP |
Synonyms | POMP; proteasome maturation protein; C13orf12, chromosome 13 open reading frame 12; HSPC014; proteassemblin; UMP1; hUMP1; 2510048O06Rik; protein UMP1 homolog; voltage-gated K channel beta subunit 4.1; voltage-gated potassium channel beta subunit 4.1; C13orf12; PNAS-110; |
Gene ID | 51371 |
mRNA Refseq | NM_015932 |
Protein Refseq | NP_057016 |
MIM | 613386 |
UniProt ID | Q9Y244 |
◆ Recombinant Proteins | ||
POMP-3524R | Recombinant Rhesus monkey POMP Protein, His-tagged | +Inquiry |
POMP-1771HF | Recombinant Full Length Human POMP Protein, GST-tagged | +Inquiry |
Pomp-5012M | Recombinant Mouse Pomp Protein, Myc/DDK-tagged | +Inquiry |
POMP-13119M | Recombinant Mouse POMP Protein | +Inquiry |
POMP-521H | Recombinant Human POMP Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
POMP-3017HCL | Recombinant Human POMP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All POMP Products
Required fields are marked with *
My Review for All POMP Products
Required fields are marked with *
0
Inquiry Basket