Recombinant Human POP7 protein, GST-tagged

Cat.No. : POP7-301613H
Product Overview : Recombinant Human POP7 (1-140 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Met1-Lys140
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : MAENREPRGAVEAELDPVEYTLRKRLPSRLPRRPNDIYVNMKTDFKAQLARCQKLLDGGARGQNACSEIYIHGLGLAINRAINIALQLQAGSFGSLQVAANTSTVELVDELEPETDTREPLTRIRNNSAIHIRVFRVTPK
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name POP7 processing of precursor 7, ribonuclease P/MRP subunit (S. cerevisiae) [ Homo sapiens ]
Official Symbol POP7
Synonyms POP7; processing of precursor 7, ribonuclease P/MRP subunit (S. cerevisiae); processing of precursor 7, ribonuclease P subunit (S. cerevisiae); ribonuclease P protein subunit p20; RPP2; RPP20; hPOP7; RNaseP protein p20; ribonucleases P/MRP protein subunit POP7 homolog; processing of precursor 7, ribonuclease P subunit; POP7 (processing of precursor, S. cerevisiae) homolog; 0610037N12Rik;
Gene ID 10248
mRNA Refseq NM_005837
Protein Refseq NP_005828
MIM 606113
UniProt ID O75817

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All POP7 Products

Required fields are marked with *

My Review for All POP7 Products

Required fields are marked with *

0
cart-icon