Recombinant Human POP7 protein, GST-tagged
Cat.No. : | POP7-301613H |
Product Overview : | Recombinant Human POP7 (1-140 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Lys140 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MAENREPRGAVEAELDPVEYTLRKRLPSRLPRRPNDIYVNMKTDFKAQLARCQKLLDGGARGQNACSEIYIHGLGLAINRAINIALQLQAGSFGSLQVAANTSTVELVDELEPETDTREPLTRIRNNSAIHIRVFRVTPK |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | POP7 processing of precursor 7, ribonuclease P/MRP subunit (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | POP7 |
Synonyms | POP7; processing of precursor 7, ribonuclease P/MRP subunit (S. cerevisiae); processing of precursor 7, ribonuclease P subunit (S. cerevisiae); ribonuclease P protein subunit p20; RPP2; RPP20; hPOP7; RNaseP protein p20; ribonucleases P/MRP protein subunit POP7 homolog; processing of precursor 7, ribonuclease P subunit; POP7 (processing of precursor, S. cerevisiae) homolog; 0610037N12Rik; |
Gene ID | 10248 |
mRNA Refseq | NM_005837 |
Protein Refseq | NP_005828 |
MIM | 606113 |
UniProt ID | O75817 |
◆ Recombinant Proteins | ||
POP7-3527R | Recombinant Rhesus monkey POP7 Protein, His-tagged | +Inquiry |
POP7-256H | Recombinant Human POP7, His-tagged | +Inquiry |
POP7-1861H | Recombinant Human POP7, His-tagged | +Inquiry |
POP7-13127M | Recombinant Mouse POP7 Protein | +Inquiry |
POP7-6944M | Recombinant Mouse POP7 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
POP7-3009HCL | Recombinant Human POP7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All POP7 Products
Required fields are marked with *
My Review for All POP7 Products
Required fields are marked with *