Recombinant Human POP7 protein, GST-tagged

• Cat.No.: POP7-301613H
• Product Overview: Recombinant Human POP7 (1-140 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Met1-Lys140
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: MAENREPRGAVEAELDPVEYTLRKRLPSRLPRRPNDIYVNMKTDFKAQLARCQKLLDGGARGQNACSEIYIHGLGLAINRAINIALQLQAGSFGSLQVAANTSTVELVDELEPETDTREPLTRIRNNSAIHIRVFRVTPK
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: POP7 processing of precursor 7, ribonuclease P/MRP subunit (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: POP7
• Synonyms: POP7; processing of precursor 7, ribonuclease P/MRP subunit (S. cerevisiae); processing of precursor 7, ribonuclease P subunit (S. cerevisiae); ribonuclease P protein subunit p20; RPP2; RPP20; hPOP7; RNaseP protein p20; ribonucleases P/MRP protein subunit POP7 homolog; processing of precursor 7, ribonuclease P subunit; POP7 (processing of precursor, S. cerevisiae) homolog; 0610037N12Rik
• Gene ID: 10248
• mRNA Refseq: NM_005837
• Protein Refseq: NP_005828
• MIM: 606113
• UniProt ID: O75817