Recombinant Human POSTN protein, GST-tagged

Cat.No. : POSTN-1843H
Product Overview : Recombinant Human POSTN protein(473-669 aa), fused to GST tag, was expressed in E. coli.
Availability October 05, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 473-669 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : MEKGSKQGRNGAIHIFREIIKPAEKSLHEKLKQDKRFSTFLSLLEAADLKELLTQPGDWTLFVPTNDAFKGMTSEEKEILIRDKNALQNIILYHLTPGVFIGKGFEPGVTNILKTTQGSKIFLKEVNDTLLVNELKSKESDIMTTNGVIHVVDKLLYPADTPVGNDQLLEILNKLIKYIQIKFVRGSTFKEIPVTVY
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name POSTN periostin, osteoblast specific factor [ Homo sapiens ]
Official Symbol POSTN
Synonyms POSTN; periostin, osteoblast specific factor; periostin; OSF 2; PN; periostin isoform thy2; periostin isoform thy4; periostin isoform thy6; periostin isoform thy8; osteoblast-specific factor 2; periodontal ligament-specific periostin; osteoblast specific factor 2 (fasciclin I-like); OSF2; OSF-2; PDLPOSTN; RP11-412K4.1; MGC119510; MGC119511;
Gene ID 10631
mRNA Refseq NM_001135934
Protein Refseq NP_001129406
MIM 608777
UniProt ID Q15063

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All POSTN Products

Required fields are marked with *

My Review for All POSTN Products

Required fields are marked with *

0
cart-icon
0
compare icon