Recombinant Human POSTN protein, GST-tagged
Cat.No. : | POSTN-1843H |
Product Overview : | Recombinant Human POSTN protein(473-669 aa), fused to GST tag, was expressed in E. coli. |
Availability | July 23, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 473-669 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MEKGSKQGRNGAIHIFREIIKPAEKSLHEKLKQDKRFSTFLSLLEAADLKELLTQPGDWTLFVPTNDAFKGMTSEEKEILIRDKNALQNIILYHLTPGVFIGKGFEPGVTNILKTTQGSKIFLKEVNDTLLVNELKSKESDIMTTNGVIHVVDKLLYPADTPVGNDQLLEILNKLIKYIQIKFVRGSTFKEIPVTVY |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | POSTN periostin, osteoblast specific factor [ Homo sapiens ] |
Official Symbol | POSTN |
Synonyms | POSTN; periostin, osteoblast specific factor; periostin; OSF 2; PN; periostin isoform thy2; periostin isoform thy4; periostin isoform thy6; periostin isoform thy8; osteoblast-specific factor 2; periodontal ligament-specific periostin; osteoblast specific factor 2 (fasciclin I-like); OSF2; OSF-2; PDLPOSTN; RP11-412K4.1; MGC119510; MGC119511; |
Gene ID | 10631 |
mRNA Refseq | NM_001135934 |
Protein Refseq | NP_001129406 |
MIM | 608777 |
UniProt ID | Q15063 |
◆ Recombinant Proteins | ||
Postn-6769M | Recombinant Full Length Mouse Postn Protein, Isoform 1, C-His tagged | +Inquiry |
Postn-736R | Recombinant Rat Postn Protein, His-tagged | +Inquiry |
Postn-6770M | Recombinant Mouse Postn Protein (Met1-Gln838), C-His tagged | +Inquiry |
Postn-695M | Active Recombinant Mouse Postn Protein, Isoform 2, His-tagged | +Inquiry |
POSTN-072H | Recombinant Human POSTN protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
POSTN-2269MCL | Recombinant Mouse POSTN cell lysate | +Inquiry |
POSTN-2756HCL | Recombinant Human POSTN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All POSTN Products
Required fields are marked with *
My Review for All POSTN Products
Required fields are marked with *