Recombinant Human POU2F2 protein, His-tagged

Cat.No. : POU2F2-7855H
Product Overview : Recombinant Human POU2F2 protein(1-75 aa), fused with N-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-75 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
AASequence : MVHSSMGAPEIRMSKPLEAEKQGLDSPSEHTDTERNGPDTNHQNPQNKTSPFSVSPTGPSTKIKAEDPSGDSAPA
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name POU2F2 POU class 2 homeobox 2 [ Homo sapiens ]
Official Symbol POU2F2
Synonyms POU2F2; POU class 2 homeobox 2; OTF2, POU domain class 2, transcription factor 2; POU domain, class 2, transcription factor 2; OCT2; OTF-2; homeobox protein; octamer-binding protein 2; octamer-binding transcription factor 2; lymphoid-restricted immunoglobulin octamer-binding protein NF-A2; OTF2; Oct-2;
Gene ID 5452
mRNA Refseq NM_001207025
Protein Refseq NP_001193954
MIM 164176
UniProt ID P09086

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All POU2F2 Products

Required fields are marked with *

My Review for All POU2F2 Products

Required fields are marked with *

0
cart-icon