Recombinant Human POU2F2 protein, His-tagged
| Cat.No. : | POU2F2-7855H |
| Product Overview : | Recombinant Human POU2F2 protein(1-75 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-75 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | MVHSSMGAPEIRMSKPLEAEKQGLDSPSEHTDTERNGPDTNHQNPQNKTSPFSVSPTGPSTKIKAEDPSGDSAPA |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | POU2F2 POU class 2 homeobox 2 [ Homo sapiens ] |
| Official Symbol | POU2F2 |
| Synonyms | POU2F2; POU class 2 homeobox 2; OTF2, POU domain class 2, transcription factor 2; POU domain, class 2, transcription factor 2; OCT2; OTF-2; homeobox protein; octamer-binding protein 2; octamer-binding transcription factor 2; lymphoid-restricted immunoglobulin octamer-binding protein NF-A2; OTF2; Oct-2; |
| Gene ID | 5452 |
| mRNA Refseq | NM_001207025 |
| Protein Refseq | NP_001193954 |
| MIM | 164176 |
| UniProt ID | P09086 |
| ◆ Recombinant Proteins | ||
| POU2F2-7855H | Recombinant Human POU2F2 protein, His-tagged | +Inquiry |
| POU2F2-6951M | Recombinant Mouse POU2F2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| POU2F2-7112H | Recombinant Human POU2F2 protein, His & T7-tagged | +Inquiry |
| Pou2f2-7113R | Recombinant Rat Pou2f2 protein, His & T7-tagged | +Inquiry |
| POU2F2-4962H | Recombinant Human POU2F2 Protein (Phe236-Thr398), N-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| POU2F2-1394HCL | Recombinant Human POU2F2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All POU2F2 Products
Required fields are marked with *
My Review for All POU2F2 Products
Required fields are marked with *
