Recombinant Human POU3F4 protein, His-tagged
Cat.No. : | POU3F4-0422H |
Product Overview : | Recombinant Human POU3F4 protein(10-181 aa), fused to His tag, was expressed in E. coli. |
Availability | July 02, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 10-181 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | SILSSTSLVHADSAGMQQGSPFRNPQKLLQSDYLQGVPSNGHPLGHHWVTSLSDGGPWSSTLATSPLDQQDVKPGREDLQLGAIIHHRSPHVAHHSPHTNHPNAWGASPAPNPSITSSGQPLNVYSQPGFTVSGMLEHGGLTPPPAAASAQSLHPVLREPPDHGELGSHHCQ |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | POU3F4 POU class 3 homeobox 4 [ Homo sapiens ] |
Official Symbol | POU3F4 |
Synonyms | BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9; OTF-9; OTF9 |
Gene ID | 5456 |
mRNA Refseq | NM_000307.4 |
Protein Refseq | NP_000298.3 |
MIM | 300039 |
UniProt ID | P49335 |
◆ Recombinant Proteins | ||
POU3F4-0422H | Recombinant Human POU3F4 protein, His-tagged | +Inquiry |
POU3F4-2607H | Recombinant Human POU3F4 Protein, MYC/DDK-tagged | +Inquiry |
POU3F4-3350R | Recombinant Rhesus Macaque POU3F4 Protein, His (Fc)-Avi-tagged | +Inquiry |
Pou3f4-5021M | Recombinant Mouse Pou3f4 Protein, Myc/DDK-tagged | +Inquiry |
POU3F4-4586R | Recombinant Rat POU3F4 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
POU3F4-1395HCL | Recombinant Human POU3F4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All POU3F4 Products
Required fields are marked with *
My Review for All POU3F4 Products
Required fields are marked with *