Recombinant Human PP2A protein, GST-tagged
| Cat.No. : | PP2A-301107H |
| Product Overview : | Recombinant Human PP2A (52-230 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Ile52-His230 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | ILTLNEGVKGKKLTFEYRVSEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDH |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | PTPA protein phosphatase 2 phosphatase activator [ Homo sapiens (human) ] |
| Official Symbol | PP2A |
| Synonyms | PTPA; PR53; PPP2R4 |
| Gene ID | 5524 |
| mRNA Refseq | NM_001193397 |
| Protein Refseq | NP_001180326 |
| MIM | 600756 |
| UniProt ID | Q15257 |
| ◆ Recombinant Proteins | ||
| PP2A-301107H | Recombinant Human PP2A protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PP2A Products
Required fields are marked with *
My Review for All PP2A Products
Required fields are marked with *
