Recombinant Human PPAN Protein (1-473 aa), His-tagged
Cat.No. : | PPAN-1711H |
Product Overview : | Recombinant Human PPAN Protein (1-473 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-473 aa |
Description : | May have a role in cell growth. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 55.2 kDa |
AA Sequence : | MGQSGRSRHQKRARAQAQLRNLEAYAANPHSFVFTRGCTGRNIRQLSLDVRRVMEPLTASRLQVRKKNSLKDCVAVAGPLGVTHFLILSKTETNVYFKLMRLPGGPTLTFQVKKYSLVRDVVSSLRRHRMHEQQFAHPPLLVLNSFGPHGMHVKLMATMFQNLFPSINVHKVNLNTIKRCLLIDYNPDSQELDFRHYSIKVVPVGASRGMKKLLQEKFPNMSRLQDISELLATGAGLSESEAEPDGDHNITELPQAVAGRGNMRAQQSAVRLTEIGPRMTLQLIKVQEGVGEGKVMFHSFVSKTEEELQAILEAKEKKLRLKAQRQAQQAQNVQRKQEQREAHRKKSLEGMKKARVGGSDEEASGIPSRTASLELGEDDDEQEDDDIEYFCQAVGEAPSEDLFPEAKQKRLAKSPGRKRKRWEMDRGRGRLCDQKFPKTKDKSQGAQARRGPRGASRDGGRGRGRGRPGKRVA |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | PPAN peter pan homolog [ Homo sapiens (human) ] |
Official Symbol | PPAN |
Synonyms | SSF; SSF1; SSF2; BXDC3; SSF-1; |
Gene ID | 56342 |
mRNA Refseq | NM_020230 |
Protein Refseq | NP_064615 |
UniProt ID | Q9NQ55 |
◆ Recombinant Proteins | ||
PPAN-3534R | Recombinant Rhesus monkey PPAN Protein, His-tagged | +Inquiry |
PPAN-3352R | Recombinant Rhesus Macaque PPAN Protein, His (Fc)-Avi-tagged | +Inquiry |
PPAN-400H | Recombinant Human PPAN Protein, GST-His-tagged | +Inquiry |
PPAN-11509Z | Recombinant Zebrafish PPAN | +Inquiry |
PPAN-1711H | Recombinant Human PPAN Protein (1-473 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPAN-2993HCL | Recombinant Human PPAN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPAN Products
Required fields are marked with *
My Review for All PPAN Products
Required fields are marked with *