Recombinant Human PPAP2B, GST-tagged
Cat.No. : | PPAP2B-28H |
Product Overview : | Recombinant Human PPAP2B(1 a.a. - 311 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. This protein is a membrane glycoprotein localized at the cell plasma membrane. It has been shown to actively hydrolyze extracellular lysophosphatidic acid and short-chain phosphatidic acid. The expression of this gene is found to be enhanced by epidermal growth factor in Hela cells. |
Molecular Mass : | 59.95 kDa |
AA Sequence : | MQNYKYDKAIVPESKNGGSPALNNNPRRSGSKRVLLICLDLFCLFMAGLPFLIIETSTIKPYHRGFYCNDESIKY PLKTGETINDAVLCAVGIVIAILAIITGEFYRIYYLKKSRSTIQNPYVAALYKQVGCFLFGCAISQSFTDIAKVS IGRLRPHFLSVCNPDFSQINCSEGYIQNYRCRGDDSKVQEARKSFFSGHASFSMYTMLYLVLYLQARFTWRGARL LRPLLQFTLIMMAFYTGLSRVSDHKHHPSDVLAGFAQGALVACCIVFFVSDLFKTKMTLSLPAPAIRKEILSPVD IIDRNNHHNMM |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | PPAP2B phosphatidic acid phosphatase type 2B [ Homo sapiens ] |
Official Symbol | PPAP2B |
Synonyms | PPAP2B; LPP3; VCIP; Dri42; PAP2B; phosphatidic acid phosphatase type 2B; lipid phosphate phosphohydrolase 3; PAP2 beta; phosphatidate phosphohydrolase type 2b; type-2 phosphatidic acid phosphatase-beta; vascular endothelial growth factor and type I collagen inducible; NP_003704.3; EC 3.1.3.4 |
Gene ID | 8613 |
mRNA Refseq | NM_003713 |
Protein Refseq | NP_003704 |
MIM | 607125 |
UniProt ID | O14495 |
Chromosome Location | 1p32.2 |
Pathway | Ether lipid metabolism; Fat digestion and absorption; Fc gamma R-mediated phagocytosis |
Function | integrin binding; lipid phosphatase activity; phosphatidate phosphatase activity |
◆ Recombinant Proteins | ||
PPAP2B-386HF | Recombinant Full Length Human PPAP2B Protein, GST-tagged | +Inquiry |
PPAP2B-3853C | Recombinant Chicken PPAP2B | +Inquiry |
PPAP2B-28H | Recombinant Human PPAP2B, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPAP2B-2991HCL | Recombinant Human PPAP2B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPAP2B Products
Required fields are marked with *
My Review for All PPAP2B Products
Required fields are marked with *