Recombinant Human PPAP2B, GST-tagged

Cat.No. : PPAP2B-28H
Product Overview : Recombinant Human PPAP2B(1 a.a. - 311 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. This protein is a membrane glycoprotein localized at the cell plasma membrane. It has been shown to actively hydrolyze extracellular lysophosphatidic acid and short-chain phosphatidic acid. The expression of this gene is found to be enhanced by epidermal growth factor in Hela cells.
Molecular Mass : 59.95 kDa
AA Sequence : MQNYKYDKAIVPESKNGGSPALNNNPRRSGSKRVLLICLDLFCLFMAGLPFLIIETSTIKPYHRGFYCNDESIKY PLKTGETINDAVLCAVGIVIAILAIITGEFYRIYYLKKSRSTIQNPYVAALYKQVGCFLFGCAISQSFTDIAKVS IGRLRPHFLSVCNPDFSQINCSEGYIQNYRCRGDDSKVQEARKSFFSGHASFSMYTMLYLVLYLQARFTWRGARL LRPLLQFTLIMMAFYTGLSRVSDHKHHPSDVLAGFAQGALVACCIVFFVSDLFKTKMTLSLPAPAIRKEILSPVD IIDRNNHHNMM
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name PPAP2B phosphatidic acid phosphatase type 2B [ Homo sapiens ]
Official Symbol PPAP2B
Synonyms PPAP2B; LPP3; VCIP; Dri42; PAP2B; phosphatidic acid phosphatase type 2B; lipid phosphate phosphohydrolase 3; PAP2 beta; phosphatidate phosphohydrolase type 2b; type-2 phosphatidic acid phosphatase-beta; vascular endothelial growth factor and type I collagen inducible; NP_003704.3; EC 3.1.3.4
Gene ID 8613
mRNA Refseq NM_003713
Protein Refseq NP_003704
MIM 607125
UniProt ID O14495
Chromosome Location 1p32.2
Pathway Ether lipid metabolism; Fat digestion and absorption; Fc gamma R-mediated phagocytosis
Function integrin binding; lipid phosphatase activity; phosphatidate phosphatase activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PPAP2B Products

Required fields are marked with *

My Review for All PPAP2B Products

Required fields are marked with *

0
cart-icon