Recombinant Human PPARGC1B protein, His&Myc-tagged
Cat.No. : | PPARGC1B-4646H |
Product Overview : | Recombinant Human PPARGC1B protein(Q86YN6)(868-1023aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 868-1023a.a. |
Tag : | His&Myc |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 25.6 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | TRRNFRCESRGPCSDRTPSIRHARKRREKAIGEGRVVYIQNLSSDMSSRELKRRFEVFGEIEECEVLTRNRRGEKYGFITYRCSEHAALSLTKGAALRKRNEPSFQLSYGGLRHFCWPRYTDYDSNSEEALPASGKSKYEAMDFDSLLKEAQQSLH |
Gene Name | PPARGC1B peroxisome proliferator-activated receptor gamma, coactivator 1 beta [ Homo sapiens ] |
Official Symbol | PPARGC1B |
Synonyms | PPARGC1B; peroxisome proliferator-activated receptor gamma, coactivator 1 beta; peroxisome proliferative activated receptor, gamma, coactivator 1, beta; peroxisome proliferator-activated receptor gamma coactivator 1-beta; PERC; PGC1B; PPARGC-1-beta; PPAR-gamma coactivator 1-beta; PGC-1-related estrogen receptor alpha coactivator; ERRL1; PGC-1(beta); FLJ14284; DKFZp686C1790; |
Gene ID | 133522 |
mRNA Refseq | NM_133263 |
Protein Refseq | NP_573570 |
MIM | 608886 |
UniProt ID | Q86YN6 |
◆ Recombinant Proteins | ||
PPARGC1B-4254R | Recombinant Rat PPARGC1B Protein, His (Fc)-Avi-tagged | +Inquiry |
PPARGC1B-1873H | Recombinant Human PPARGC1B, GST-tagged | +Inquiry |
PPARGC1B-13164M | Recombinant Mouse PPARGC1B Protein | +Inquiry |
PPARGC1B-4646H | Recombinant Human PPARGC1B protein, His&Myc-tagged | +Inquiry |
PPARGC1B-6971M | Recombinant Mouse PPARGC1B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPARGC1B-2984HCL | Recombinant Human PPARGC1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPARGC1B Products
Required fields are marked with *
My Review for All PPARGC1B Products
Required fields are marked with *