Recombinant Human PPARGC1B protein, His&Myc-tagged

• Cat.No.: PPARGC1B-4646H
• Product Overview: Recombinant Human PPARGC1B protein(Q86YN6)(868-1023aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc
• Protein Length: 868-1023a.a.
• Tag: His&Myc
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 25.6 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: TRRNFRCESRGPCSDRTPSIRHARKRREKAIGEGRVVYIQNLSSDMSSRELKRRFEVFGEIEECEVLTRNRRGEKYGFITYRCSEHAALSLTKGAALRKRNEPSFQLSYGGLRHFCWPRYTDYDSNSEEALPASGKSKYEAMDFDSLLKEAQQSLH

Gene Information

• Gene Name: PPARGC1B peroxisome proliferator-activated receptor gamma, coactivator 1 beta [ Homo sapiens ]
• Official Symbol: PPARGC1B
• Synonyms: PPARGC1B; peroxisome proliferator-activated receptor gamma, coactivator 1 beta; peroxisome proliferative activated receptor, gamma, coactivator 1, beta; peroxisome proliferator-activated receptor gamma coactivator 1-beta; PERC; PGC1B; PPARGC-1-beta; PPAR-gamma coactivator 1-beta; PGC-1-related estrogen receptor alpha coactivator; ERRL1; PGC-1(beta); FLJ14284; DKFZp686C1790
• Gene ID: 133522
• mRNA Refseq: NM_133263
• Protein Refseq: NP_573570
• MIM: 608886
• UniProt ID: Q86YN6