Recombinant Human PPBP protein
Cat.No. : | PPBP-04H PPBP |
Product Overview : | Recombinant Human PPBP protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 70 |
Description : | Neutrophil activating protein-2 also named CXCL7 is an isoform of Beta-Thromboglobulin or Pro-Platelet basic protein. It belongs to the CXC chemokine family and is released in large amounts from platelets following their activation. CXCL7 stimulates DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by human synovial cells. Recombinant human CXCL7 contains 70 amino acids which is a single non-glycosylated polypeptide chain. In addition, The human CXCL7 shares 53 % and 58 % a.a. sequence identity with mouse and rat CXCL7. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 50 mM NaCl. |
Bio-activity : | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood neutrophils is in a concentration range of 1.0-10.0 ng/ml. |
Molecular Mass : | Approximately 7.6 kDa, a single non-glycosylated polypeptide chain containing 70 amino acids. |
AA Sequence : | AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD |
Endotoxin : | Less than 1 EU/μg of rHuNAP-2/CXCL7 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | PPBP |
Official Symbol | PPBP |
Synonyms | PPBP; pro-platelet basic protein (chemokine (C-X-C motif) ligand 7); THBGB1; platelet basic protein; b TG1; Beta TG; beta thromboglobulin; connective tissue activating peptide III; CTAP3; CTAPIII; CXCL7; LA PF4; LDGF; MDGF; NAP 2; NAP 2 L1; neutrophil activating peptide 2; PBP; SCYB7; TGB; TGB1; thrombocidin 1; thrombocidin 2; beta-thromboglobulin; CXC chemokine ligand 7; C-X-C motif chemokine 7; thromboglobulin, beta-1; small inducible cytokine B7; small-inducible cytokine B7; leukocyte-derived growth factor; low-affinity platelet factor IV; neutrophil-activating peptide 2; neutrophil-activating peptide-2; macrophage-derived growth factor; connective tissue-activating peptide III; small inducible cytokine subfamily B, member 7; TC1; TC2; B-TG1; NAP-2; THBGB; LA-PF4; SCAR10; Beta-TG; CTAP-III; |
Gene ID | 5473 |
mRNA Refseq | NM_002704 |
Protein Refseq | NP_002695 |
MIM | 121010 |
UniProt ID | P02775 |
◆ Recombinant Proteins | ||
PPBP-1073R | Recombinant Rat PPBP Protein, Fc-tagged | +Inquiry |
PPBP-3084H | Recombinant Human PPBP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PPBP-1195C | Recombinant Cynomolgus PPBP Protein, Fc-tagged | +Inquiry |
Ppbp-521R | Recombinant Rat Ppbp Protein, His-tagged | +Inquiry |
Ppbp-448R | Active Recombinant Rat Pro-Platelet Basic Protein (chemokine (C-X-C motif) ligand 7) | +Inquiry |
◆ Native Proteins | ||
PPBP-30279TH | Native Human PPBP | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPBP-1616RCL | Recombinant Rat PPBP cell lysate | +Inquiry |
PPBP-1397CCL | Recombinant Cynomolgus PPBP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PPBP Products
Required fields are marked with *
My Review for All PPBP Products
Required fields are marked with *
0
Inquiry Basket