Recombinant Human PPFIA4 protein, GST-tagged

• Cat.No.: PPFIA4-6742H
• Product Overview: Recombinant Human PPFIA4 protein(1-78 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-78 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• AA Sequence: MGSAADVRFSLGTTTHAPPGVHRRYSALREESAKDWETSPLPGMLAPAAGPAFDSDPEISDVDEDEPGGLVGSADVVS
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Gene Information

• Official Symbol: PPFIA4
• Synonyms: PPFIA4; protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 4; liprin-alpha-4; Liprin alpha4; Liprin-alpha4; liprin alpha4; PTPRF-interacting protein alpha-4; protein tyrosine phosphatase receptor type f polypeptide-interacting protein alpha-4
• Gene ID: 8497
• mRNA Refseq: NM_015053
• Protein Refseq: NP_055868
• MIM: 603145
• UniProt ID: O75335