Recombinant Human PPFIA4 protein, His-tagged

Cat.No. : PPFIA4-1881H
Product Overview : Recombinant Human PPFIA4 protein(1-78 aa), fused with N-terminal His tag, was expressed in E. coli.
Availability May 28, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-78 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
AA Sequence : MGSAADVRFSLGTTTHAPPGVHRRYSALREESAKDWETSPLPGMLAPAAGPAFDSDPEISDVDEDEPGGLVGSADVVS
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Official Symbol PPFIA4
Synonyms PPFIA4; protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 4; liprin-alpha-4; Liprin alpha4; Liprin-alpha4; liprin alpha4; PTPRF-interacting protein alpha-4; protein tyrosine phosphatase receptor type f polypeptide-interacting protein alpha-4;
Gene ID 8497
mRNA Refseq NM_015053
Protein Refseq NP_055868
MIM 603145
UniProt ID O75335

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PPFIA4 Products

Required fields are marked with *

My Review for All PPFIA4 Products

Required fields are marked with *

0
cart-icon
0
compare icon