Recombinant Human PPFIA4 protein, His-tagged
Cat.No. : | PPFIA4-1881H |
Product Overview : | Recombinant Human PPFIA4 protein(1-78 aa), fused with N-terminal His tag, was expressed in E. coli. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-78 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | MGSAADVRFSLGTTTHAPPGVHRRYSALREESAKDWETSPLPGMLAPAAGPAFDSDPEISDVDEDEPGGLVGSADVVS |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | PPFIA4 |
Synonyms | PPFIA4; protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 4; liprin-alpha-4; Liprin alpha4; Liprin-alpha4; liprin alpha4; PTPRF-interacting protein alpha-4; protein tyrosine phosphatase receptor type f polypeptide-interacting protein alpha-4; |
Gene ID | 8497 |
mRNA Refseq | NM_015053 |
Protein Refseq | NP_055868 |
MIM | 603145 |
UniProt ID | O75335 |
◆ Recombinant Proteins | ||
PPFIA4-1881H | Recombinant Human PPFIA4 protein, His-tagged | +Inquiry |
PPFIA4-4599R | Recombinant Rat PPFIA4 Protein | +Inquiry |
PPFIA4-4258R | Recombinant Rat PPFIA4 Protein, His (Fc)-Avi-tagged | +Inquiry |
PPFIA4-6742H | Recombinant Human PPFIA4 protein, GST-tagged | +Inquiry |
PPFIA4-5886Z | Recombinant Zebrafish PPFIA4 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPFIA4 Products
Required fields are marked with *
My Review for All PPFIA4 Products
Required fields are marked with *