Recombinant Human PPIA protein

Cat.No. : PPIA-26334H
Product Overview : Recombinant human PPIA (1-165aa) without tag was expressed in E. coli and purified by using conventional chromatography techniques.
Availability February 05, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 1-165
Description : This gene encodes a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. The encoded protein is a cyclosporin binding-protein and may play a role in cyclosporin A-mediated immunosuppression. The protein can also interact with several HIV proteins, including p55 gag, Vpr, and capsid protein, and has been shown to be necessary for the formation of infectious HIV virions. Multiple pseudogenes that map to different chromosomes have been reported.
Source : E. coli
Species : Human
Form : Liquid
Bio-activity : Specific activity is > 650 nmol/min/mg, and is defined as the amount of enzyme that cleaves 1nmole of suc-AAFP-PNA per minute at 37 centigrade in Tris-HCl pH 8.0 using chymotrypsin.
Molecular Mass : 20 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 95% by SDS-PAGE
Applications : SDS-PAGE, Enzyme Activity
Storage : Can be stored at 2-8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 1 mg/mL (determined by Bradford assay)
Storage Buffer : 20mM Tris-HCl buffer (pH 8.0) containing 20mM NaCl, 0.5mM DTT, 10% glycerol
Gene Name PPIA peptidylprolyl isomerase A [ Homo sapiens (human) ]
Official Symbol PPIA
Synonyms PPIA; peptidylprolyl isomerase A; CYPA; CYPH; HEL-S-69p; peptidyl-prolyl cis-trans isomerase A; PPIase A; T cell cyclophilin; cyclosporin A-binding protein; epididymis secretory sperm binding protein Li 69p; peptidylprolyl isomerase A (cyclophilin A); rotamase A; EC 5.2.1.8
Gene ID 5478
mRNA Refseq NM_021130
Protein Refseq NP_066953
MIM 123840
UniProt ID P62937

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PPIA Products

Required fields are marked with *

My Review for All PPIA Products

Required fields are marked with *

0
cart-icon
0
compare icon