Recombinant Human PPIA protein

• Cat.No.: PPIA-26334H
• Product Overview: Recombinant human PPIA (1-165aa) without tag was expressed in E. coli and purified by using conventional chromatography techniques.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 1-165
• Description: This gene encodes a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. The encoded protein is a cyclosporin binding-protein and may play a role in cyclosporin A-mediated immunosuppression. The protein can also interact with several HIV proteins, including p55 gag, Vpr, and capsid protein, and has been shown to be necessary for the formation of infectious HIV virions. Multiple pseudogenes that map to different chromosomes have been reported.
• Source: E. coli
• Species: Human
• Form: Liquid
• Bio-activity: Specific activity is > 650 nmol/min/mg, and is defined as the amount of enzyme that cleaves 1nmole of suc-AAFP-PNA per minute at 37 centigrade in Tris-HCl pH 8.0 using chymotrypsin.
• Molecular Mass: 20 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 95% by SDS-PAGE
• Applications: SDS-PAGE, Enzyme Activity
• Storage: Can be stored at 2-8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 1 mg/mL (determined by Bradford assay)
• Storage Buffer: 20mM Tris-HCl buffer (pH 8.0) containing 20mM NaCl, 0.5mM DTT, 10% glycerol

Gene Information

• Gene Name: PPIA peptidylprolyl isomerase A [ Homo sapiens (human) ]
• Official Symbol: PPIA
• Synonyms: PPIA; peptidylprolyl isomerase A; CYPA; CYPH; HEL-S-69p; peptidyl-prolyl cis-trans isomerase A; PPIase A; T cell cyclophilin; cyclosporin A-binding protein; epididymis secretory sperm binding protein Li 69p; peptidylprolyl isomerase A (cyclophilin A); rotamase A; EC 5.2.1.8
• Gene ID: 5478
• mRNA Refseq: NM_021130
• Protein Refseq: NP_066953
• MIM: 123840
• UniProt ID: P62937