Recombinant Human PPIA protein, GST-tagged
Cat.No. : | PPIA-4081H |
Product Overview : | Recombinant Human PPIA protein(P62937)(2-165aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 2-165aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 44.9 kDa |
AA Sequence : | VNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | PPIA peptidylprolyl isomerase A (cyclophilin A) [ Homo sapiens ] |
Official Symbol | PPIA |
Synonyms | PPIA; peptidylprolyl isomerase A (cyclophilin A); peptidyl-prolyl cis-trans isomerase A; CYPA; PPIase A; rotamase A; cyclophilin; T cell cyclophilin; cyclosporin A-binding protein; CYPH; MGC12404; MGC23397; MGC117158; |
Gene ID | 5478 |
mRNA Refseq | NM_021130 |
Protein Refseq | NP_066953 |
MIM | 123840 |
UniProt ID | P62937 |
◆ Recombinant Proteins | ||
PPIA-4259R | Recombinant Rat PPIA Protein, His (Fc)-Avi-tagged | +Inquiry |
PPIA-60H | Recombinant Human PPIA, His-tagged | +Inquiry |
PPIA-5690P | Recombinant Pig PPIA protein, His-tagged | +Inquiry |
Ppia-872M | Recombinant Mouse Ppia Protein | +Inquiry |
PPIA-26337TH | Active Recombinant Full Length Human PPIA | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPIA-2975HCL | Recombinant Human PPIA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPIA Products
Required fields are marked with *
My Review for All PPIA Products
Required fields are marked with *