Species : |
Mouse |
Source : |
E.coli |
Tag : |
Non |
Protein Length : |
1-164 a.a. |
Description : |
Peptidyl-prolyl cis-trans isomerase A is a cytoplasm protein which belongs to the cyclophilin-type PPIase family and PPIase A subfamily. Cyclophilins(CyPs) are a family of proteins found in organisms ranging from prokaryotes to humans. These molecules exhibit peptidyl-prolyl isomerase activity, suggesting that they influence the conformation of proteins in cells. Cyclophilin A accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Cyclophilin A can interact with several HIV proteins, including p55 gag, Vpr, and capsid protein, and has been shown to be necessary for the formation of infectious HIV virions. |
Form : |
Supplied as a 0.2 μm filtered solution of PBS, 10%glycerol, pH7.4. |
AA Sequence : |
MVNPTVFFDITADDEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGG DFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFG KVKEGMNIVEAMERFGSRNGKTSKKITISDCGQL |
Endotoxin : |
Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Purity : |
Greater than 95% as determined by reducing SDS-PAGE. |
Storage : |
Store at < -20 centigrade, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |