Recombinant Mouse Ppia Protein

• Cat.No.: Ppia-872M
• Product Overview: Recombinant Mouse Ppia Protein (Met1-Leu164) was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: Non
• Protein Length: 1-164 a.a.
• Description: Peptidyl-prolyl cis-trans isomerase A is a cytoplasm protein which belongs to the cyclophilin-type PPIase family and PPIase A subfamily. Cyclophilins(CyPs) are a family of proteins found in organisms ranging from prokaryotes to humans. These molecules exhibit peptidyl-prolyl isomerase activity, suggesting that they influence the conformation of proteins in cells. Cyclophilin A accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Cyclophilin A can interact with several HIV proteins, including p55 gag, Vpr, and capsid protein, and has been shown to be necessary for the formation of infectious HIV virions.
• Form: Supplied as a 0.2 μm filtered solution of PBS, 10%glycerol, pH7.4.
• AA Sequence: MVNPTVFFDITADDEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGG DFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFG KVKEGMNIVEAMERFGSRNGKTSKKITISDCGQL
• Endotoxin: Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Purity: Greater than 95% as determined by reducing SDS-PAGE.
• Storage: Store at < -20 centigrade, stable for 6 months after receipt.
  Please minimize freeze-thaw cycles.

Gene Information

• Gene Name: Ppia peptidylprolyl isomerase A [ Mus musculus ]
• Official Symbol: Ppia
• Synonyms: PPIA; peptidylprolyl isomerase A; peptidyl-prolyl cis-trans isomerase A; SP18; PPIase A; rotamase A; cyclophilin A; cyclosporin A-binding protein; Cphn; CypA; CyP-18; 2700098C05
• Gene ID: 268373
• mRNA Refseq: NM_008907
• Protein Refseq: NP_032933
• UniProt ID: P17742