Recombinant Mouse Ppia Protein

Cat.No. : Ppia-872M
Product Overview : Recombinant Mouse Ppia Protein (Met1-Leu164) was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : Non
Protein Length : 1-164 a.a.
Description : Peptidyl-prolyl cis-trans isomerase A is a cytoplasm protein which belongs to the cyclophilin-type PPIase family and PPIase A subfamily. Cyclophilins(CyPs) are a family of proteins found in organisms ranging from prokaryotes to humans. These molecules exhibit peptidyl-prolyl isomerase activity, suggesting that they influence the conformation of proteins in cells. Cyclophilin A accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Cyclophilin A can interact with several HIV proteins, including p55 gag, Vpr, and capsid protein, and has been shown to be necessary for the formation of infectious HIV virions.
Form : Supplied as a 0.2 μm filtered solution of PBS, 10%glycerol, pH7.4.
AA Sequence : MVNPTVFFDITADDEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGG DFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFG KVKEGMNIVEAMERFGSRNGKTSKKITISDCGQL
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Purity : Greater than 95% as determined by reducing SDS-PAGE.
Storage : Store at < -20 centigrade, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
Gene Name Ppia peptidylprolyl isomerase A [ Mus musculus ]
Official Symbol Ppia
Synonyms PPIA; peptidylprolyl isomerase A; peptidyl-prolyl cis-trans isomerase A; SP18; PPIase A; rotamase A; cyclophilin A; cyclosporin A-binding protein; Cphn; CypA; CyP-18; 2700098C05;
Gene ID 268373
mRNA Refseq NM_008907
Protein Refseq NP_032933
UniProt ID P17742

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Ppia Products

Required fields are marked with *

My Review for All Ppia Products

Required fields are marked with *

0
cart-icon
0
compare icon