Recombinant Mouse Ppia Protein
Cat.No. : | Ppia-872M |
Product Overview : | Recombinant Mouse Ppia Protein (Met1-Leu164) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Non |
Protein Length : | 1-164 a.a. |
Description : | Peptidyl-prolyl cis-trans isomerase A is a cytoplasm protein which belongs to the cyclophilin-type PPIase family and PPIase A subfamily. Cyclophilins(CyPs) are a family of proteins found in organisms ranging from prokaryotes to humans. These molecules exhibit peptidyl-prolyl isomerase activity, suggesting that they influence the conformation of proteins in cells. Cyclophilin A accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Cyclophilin A can interact with several HIV proteins, including p55 gag, Vpr, and capsid protein, and has been shown to be necessary for the formation of infectious HIV virions. |
Form : | Supplied as a 0.2 μm filtered solution of PBS, 10%glycerol, pH7.4. |
AA Sequence : | MVNPTVFFDITADDEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSSFHRIIPGFMCQGG DFTRHNGTGGRSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFG KVKEGMNIVEAMERFGSRNGKTSKKITISDCGQL |
Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Storage : | Store at < -20 centigrade, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
Gene Name | Ppia peptidylprolyl isomerase A [ Mus musculus ] |
Official Symbol | Ppia |
Synonyms | PPIA; peptidylprolyl isomerase A; peptidyl-prolyl cis-trans isomerase A; SP18; PPIase A; rotamase A; cyclophilin A; cyclosporin A-binding protein; Cphn; CypA; CyP-18; 2700098C05; |
Gene ID | 268373 |
mRNA Refseq | NM_008907 |
Protein Refseq | NP_032933 |
UniProt ID | P17742 |
◆ Recombinant Proteins | ||
PPIA-0216H | Recombinant Human PPIA Protein (M1-E165), Tag Free | +Inquiry |
PPIA-8311H | Active Recombinant Human PPIA, His tagged | +Inquiry |
PPIA-5692R | Recombinant Rhesus monkey PPIA protein, His-tagged | +Inquiry |
Ppia-7385M | Recombinant Mouse Ppia Protein, His-tagged | +Inquiry |
Ppia-872M | Recombinant Mouse Ppia Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPIA-2975HCL | Recombinant Human PPIA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ppia Products
Required fields are marked with *
My Review for All Ppia Products
Required fields are marked with *
0
Inquiry Basket