Recombinant Human PPIC Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PPIC-484H
• Product Overview: PPIC MS Standard C13 and N15-labeled recombinant protein (NP_000934) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase)) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. Similar to other PPIases, this protein can bind immunosuppressant cyclosporin A.
• Molecular Mass: 22.8 kDa
• AA Sequence: MGPGPRLLLPLVLCVGLGALVFSSGAEGFRKRGPSVTAKVFFDVRIGDKDVGRIVIGLFGKVVPKTVENFVALATGEKGYGYKGSKFHRVIKDFMIQGGDITTGDGTGGVSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVIDGMTVVHSIELQATDGHDRPLTNCSIINSGKIDVKTPFVVEIADWTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PPIC peptidylprolyl isomerase C [ Homo sapiens (human) ]
• Official Symbol: PPIC
• Synonyms: PPIC; peptidylprolyl isomerase C; CYPC; peptidyl-prolyl cis-trans isomerase C; PPIase C; cyclophilin C; parvulin; rotamase C; EC 5.2.1.8
• Gene ID: 5480
• mRNA Refseq: NM_000943
• Protein Refseq: NP_000934
• MIM: 123842
• UniProt ID: P45877