Recombinant Human PPIC Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PPIC-484H
Product Overview : PPIC MS Standard C13 and N15-labeled recombinant protein (NP_000934) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase)) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. Similar to other PPIases, this protein can bind immunosuppressant cyclosporin A.
Molecular Mass : 22.8 kDa
AA Sequence : MGPGPRLLLPLVLCVGLGALVFSSGAEGFRKRGPSVTAKVFFDVRIGDKDVGRIVIGLFGKVVPKTVENFVALATGEKGYGYKGSKFHRVIKDFMIQGGDITTGDGTGGVSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVIDGMTVVHSIELQATDGHDRPLTNCSIINSGKIDVKTPFVVEIADWTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PPIC peptidylprolyl isomerase C [ Homo sapiens (human) ]
Official Symbol PPIC
Synonyms PPIC; peptidylprolyl isomerase C; CYPC; peptidyl-prolyl cis-trans isomerase C; PPIase C; cyclophilin C; parvulin; rotamase C; EC 5.2.1.8
Gene ID 5480
mRNA Refseq NM_000943
Protein Refseq NP_000934
MIM 123842
UniProt ID P45877

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PPIC Products

Required fields are marked with *

My Review for All PPIC Products

Required fields are marked with *

0
cart-icon