Recombinant Human PPIF
Cat.No. : | PPIF-27049TH |
Product Overview : | Recombinant full length human Cyclophilin F; 198 amino acids, 21 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Description : | The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is part of the mitochondrial permeability transition pore in the inner mitochondrial membrane. Activation of this pore is thought to be involved in the induction of apoptotic and necrotic cell death. |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 20mM Tris, 1mM DTT, pH 7.5 |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHCSKGSGDPSSSSSSGNPLVY LDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFG YKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDEN FTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHV VFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS |
Full Length : | Full L. |
Gene Name | PPIF peptidylprolyl isomerase F [ Homo sapiens ] |
Official Symbol | PPIF |
Synonyms | PPIF; peptidylprolyl isomerase F; peptidylprolyl isomerase F (cyclophilin F); peptidyl-prolyl cis-trans isomerase F, mitochondrial; cyclophilin D; Cyp D; hCyP3; |
Gene ID | 10105 |
mRNA Refseq | NM_005729 |
Protein Refseq | NP_005720 |
MIM | 604486 |
Uniprot ID | P30405 |
Chromosome Location | 10q22-q23 |
Pathway | Toxoplasmosis, organism-specific biosystem; Toxoplasmosis, conserved biosystem; |
Function | cyclosporin A binding; isomerase activity; peptidyl-prolyl cis-trans isomerase activity; |
◆ Recombinant Proteins | ||
PPIF-6983M | Recombinant Mouse PPIF Protein, His (Fc)-Avi-tagged | +Inquiry |
PPIF-0852H | Recombinant Human PPIF Protein (S43-S207), Tag Free | +Inquiry |
PPIF-543H | Recombinant Human PPIF protein | +Inquiry |
PPIF-1429H | Active Recombinant Human Peptidylprolyl Isomerase F, His-tagged | +Inquiry |
PPIF-3547R | Recombinant Rhesus monkey PPIF Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPIF-2970HCL | Recombinant Human PPIF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPIF Products
Required fields are marked with *
My Review for All PPIF Products
Required fields are marked with *