Recombinant Human PPIF protein, T7-tagged

Cat.No. : PPIF-159H
Product Overview : Recombinant human PPIF (207 aa) protein fused with T7 Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : T7
Protein Length : 207 a.a.
Form : 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGEFMLALRCGSRWLGLLSVPRSVPLRLPAARACSKGSGDPSSSSSSGNPLVYLDVDANGKPLG RVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHV GPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro mitochondrial mediated cell apoptosis regulation study with intracellular delivery of this protein.2. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.3. May be used for mapping PPIF protein-protein interaction.4. May be used as antigen for specific antibody development.
Storage : Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name PPIF peptidylprolyl isomerase F [ Homo sapiens ]
Official Symbol PPIF
Synonyms PPIF; cyclophilin D; Cyp D; hCyP3; PPIase F; rotamase F; cyclophilin 3; cyclophilin F; CYP3; Cyp-D; FLJ90798; MGC117207;
Gene ID 10105
mRNA Refseq NM_005729
Protein Refseq NP_005720
MIM 604486
UniProt ID P30405
Chromosome Location 10q22-q23
Pathway Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem; Parkinsons disease, organism-specific biosystem; Toxoplasmosis, organism-specific biosystem; Toxoplasmosis, conserved biosystem;
Function cyclosporin A binding; isomerase activity; peptidyl-prolyl cis-trans isomerase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PPIF Products

Required fields are marked with *

My Review for All PPIF Products

Required fields are marked with *

0
cart-icon
0
compare icon