Recombinant Human PPIH Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: PPIH-4397H
• Product Overview: PPIH MS Standard C13 and N15-labeled recombinant protein (NP_006338) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is a specific component of the complex that includes pre-mRNA processing factors PRPF3, PRPF4, and PRPF18, as well as U4/U5/U6 tri-snRNP. This protein has been shown to possess PPIase activity and may act as a protein chaperone that mediates the interactions between different proteins inside the spliceosome.
• Molecular Mass: 19.2 kDa
• AA Sequence: MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEMTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: PPIH peptidylprolyl isomerase H [ Homo sapiens (human) ]
• Official Symbol: PPIH
• Synonyms: PPIH; peptidylprolyl isomerase H (cyclophilin H); peptidyl prolyl isomerase H (cyclophilin H); peptidyl-prolyl cis-trans isomerase H; cyclophilin H; CYP 20; CYPH; MGC5016; peptidyl prolyl cis trans isomerase H; PPIase h; rotamase H; small nuclear ribonucleoprotein particle specific cyclophilin H; SnuCyp 20; U snRNP associated cyclophilin SunCyp 20; USA CYP; USA CyP SnuCyp 20; USA-CyP SnuCyp-20; U-snRNP-associated cyclophilin SnuCyp-20; U-snRNP-associated cyclophilin SunCyp-20; small nuclear ribonucleoprotein particle-specific cyclophilin H; CYP-20; USA-CYP; SnuCyp-20
• Gene ID: 10465
• mRNA Refseq: NM_006347
• Protein Refseq: NP_006338
• MIM: 606095
• UniProt ID: O43447