Recombinant Human PPIH Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : PPIH-4397H
Product Overview : PPIH MS Standard C13 and N15-labeled recombinant protein (NP_006338) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is a specific component of the complex that includes pre-mRNA processing factors PRPF3, PRPF4, and PRPF18, as well as U4/U5/U6 tri-snRNP. This protein has been shown to possess PPIase activity and may act as a protein chaperone that mediates the interactions between different proteins inside the spliceosome.
Molecular Mass : 19.2 kDa
AA Sequence : MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEMTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name PPIH peptidylprolyl isomerase H [ Homo sapiens (human) ]
Official Symbol PPIH
Synonyms PPIH; peptidylprolyl isomerase H (cyclophilin H); peptidyl prolyl isomerase H (cyclophilin H); peptidyl-prolyl cis-trans isomerase H; cyclophilin H; CYP 20; CYPH; MGC5016; peptidyl prolyl cis trans isomerase H; PPIase h; rotamase H; small nuclear ribonucleoprotein particle specific cyclophilin H; SnuCyp 20; U snRNP associated cyclophilin SunCyp 20; USA CYP; USA CyP SnuCyp 20; USA-CyP SnuCyp-20; U-snRNP-associated cyclophilin SnuCyp-20; U-snRNP-associated cyclophilin SunCyp-20; small nuclear ribonucleoprotein particle-specific cyclophilin H; CYP-20; USA-CYP; SnuCyp-20;
Gene ID 10465
mRNA Refseq NM_006347
Protein Refseq NP_006338
MIM 606095
UniProt ID O43447

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PPIH Products

Required fields are marked with *

My Review for All PPIH Products

Required fields are marked with *

0
cart-icon