Recombinant Human PPIL3, His-tagged

Cat.No. : PPIL3-30678TH
Product Overview : Recombinant full length Human PPIL3 with N terminal His tag; 181 amino acids with a predicted MWt 20.3 kDa including tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 161 amino acids
Description : This gene encodes a member of the cyclophilin family. Cyclophilins catalyze the cis-trans isomerization of peptidylprolyl imide bonds in oligopeptides. They have been proposed to act either as catalysts or as molecular chaperones in protein-folding events. Alternative splicing results in multiple transcript variants.
Conjugation : HIS
Molecular Weight : 20.300kDa inclusive of tags
Tissue specificity : Ubiquitous. Detected at low levels.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 0.58% Sodium chloride, 20% Glycerol, 0.02% DTT
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMSVTLHTDVGDIKIEVFCER TPKTCENFLALCASNYYNGCIFHRNIKGFMVQTGDPTGTG RGGNSIWGKKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQ FFITYGKQPHLDMKYTVFGKVIDGLETLDELEKLPVNEKT YRPLNDVHIKDITIHANPFAQ
Sequence Similarities : Belongs to the cyclophilin-type PPIase family. PPIL3 subfamily.Contains 1 PPIase cyclophilin-type domain.
Gene Name PPIL3 peptidylprolyl isomerase (cyclophilin)-like 3 [ Homo sapiens ]
Official Symbol PPIL3
Synonyms PPIL3; peptidylprolyl isomerase (cyclophilin)-like 3; peptidyl-prolyl cis-trans isomerase-like 3; Cyclophilin J; CyPJ;
Gene ID 53938
mRNA Refseq NM_032472
Protein Refseq NP_115861
Uniprot ID Q9H2H8
Chromosome Location 2q33.1
Function isomerase activity; peptidyl-prolyl cis-trans isomerase activity; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PPIL3 Products

Required fields are marked with *

My Review for All PPIL3 Products

Required fields are marked with *

0
cart-icon