Recombinant Human PPIL3, His-tagged
Cat.No. : | PPIL3-30678TH |
Product Overview : | Recombinant full length Human PPIL3 with N terminal His tag; 181 amino acids with a predicted MWt 20.3 kDa including tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 161 amino acids |
Description : | This gene encodes a member of the cyclophilin family. Cyclophilins catalyze the cis-trans isomerization of peptidylprolyl imide bonds in oligopeptides. They have been proposed to act either as catalysts or as molecular chaperones in protein-folding events. Alternative splicing results in multiple transcript variants. |
Conjugation : | HIS |
Molecular Weight : | 20.300kDa inclusive of tags |
Tissue specificity : | Ubiquitous. Detected at low levels. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 0.58% Sodium chloride, 20% Glycerol, 0.02% DTT |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMSVTLHTDVGDIKIEVFCER TPKTCENFLALCASNYYNGCIFHRNIKGFMVQTGDPTGTG RGGNSIWGKKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQ FFITYGKQPHLDMKYTVFGKVIDGLETLDELEKLPVNEKT YRPLNDVHIKDITIHANPFAQ |
Sequence Similarities : | Belongs to the cyclophilin-type PPIase family. PPIL3 subfamily.Contains 1 PPIase cyclophilin-type domain. |
Gene Name | PPIL3 peptidylprolyl isomerase (cyclophilin)-like 3 [ Homo sapiens ] |
Official Symbol | PPIL3 |
Synonyms | PPIL3; peptidylprolyl isomerase (cyclophilin)-like 3; peptidyl-prolyl cis-trans isomerase-like 3; Cyclophilin J; CyPJ; |
Gene ID | 53938 |
mRNA Refseq | NM_032472 |
Protein Refseq | NP_115861 |
Uniprot ID | Q9H2H8 |
Chromosome Location | 2q33.1 |
Function | isomerase activity; peptidyl-prolyl cis-trans isomerase activity; protein binding; |
◆ Recombinant Proteins | ||
PPIL3-2491H | Active Recombinant Human Peptidylprolyl Isomerase (cyclophilin)-Like 3, His-tagged | +Inquiry |
Ppil3-5044M | Recombinant Mouse Ppil3 Protein, Myc/DDK-tagged | +Inquiry |
PPIL3-6986M | Recombinant Mouse PPIL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
PPIL3-4605R | Recombinant Rat PPIL3 Protein | +Inquiry |
PPIL3-301553H | Recombinant Human PPIL3 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPIL3-2966HCL | Recombinant Human PPIL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPIL3 Products
Required fields are marked with *
My Review for All PPIL3 Products
Required fields are marked with *