Recombinant Human PPIL4 protein, GST-tagged
| Cat.No. : | PPIL4-1890H |
| Product Overview : | Recombinant Human PPIL4 protein(301-492 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | January 13, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 301-492 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MDNVLIDDRRIHVDFSQSVAKVKWKGKGGKYTKSDFKEYEKEQDKPPNLVLKDKVKPKQDTKYDLILDEQAEDSKSSHSHTSKKHKKKTHHCSEEKEDEDYMPIKNTNQDIYREMGFGHYEEEESCWEKQKSEKRDRTQNRSRSRSRERDGHYSNSHKSKYQTDLYERERSKKRDRSRSPKKSKDKEKSKYR |
| Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | PPIL4 peptidylprolyl isomerase (cyclophilin)-like 4 [ Homo sapiens ] |
| Official Symbol | PPIL4 |
| Synonyms | PPIL4; peptidylprolyl isomerase (cyclophilin)-like 4; peptidyl-prolyl cis-trans isomerase-like 4; PPIase; rotamase PPIL4; cyclophilin-like protein PPIL4; cyclophilin-type peptidyl-prolyl cis-trans isomerase; serologically defined breast cancer antigen NY-BR-18; HDCME13P; |
| Gene ID | 85313 |
| mRNA Refseq | NM_139126 |
| Protein Refseq | NP_624311 |
| MIM | 607609 |
| UniProt ID | Q8WUA2 |
| ◆ Recombinant Proteins | ||
| PPIL4-13190M | Recombinant Mouse PPIL4 Protein | +Inquiry |
| PPIL4-4730H | Recombinant Human PPIL4 protein, His-SUMO-tagged | +Inquiry |
| PPIL4-29973TH | Recombinant Human PPIL4, His-tagged | +Inquiry |
| PPIL4-6846Z | Recombinant Zebrafish PPIL4 | +Inquiry |
| PPIL4-1890H | Recombinant Human PPIL4 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PPIL4-1397HCL | Recombinant Human PPIL4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPIL4 Products
Required fields are marked with *
My Review for All PPIL4 Products
Required fields are marked with *
