Recombinant Human PPP1CA, His-tagged
Cat.No. : | PPP1CA-31049TH |
Product Overview : | Recombinant full length Human PPP1A with an N terminal His tag; 350 amino acids with the tag; observed mwt: 39.7 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 330 amino acids |
Description : | The protein encoded by this gene is one of the three catalytic subunits of protein phosphatase 1 (PP1). PP1 is a serine/threonine specific protein phosphatase known to be involved in the regulation of a variety of cellular processes, such as cell division, glycogen metabolism, muscle contractility, protein synthesis, and HIV-1 viral transcription. Increased PP1 activity has been observed in the end stage of heart failure. Studies in both human and mice suggest that PP1 is an important regulator of cardiac function. Mouse studies also suggest that PP1 functions as a suppressor of learning and memory. Three alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Conjugation : | HIS |
Molecular Weight : | 39.700kDa inclusive of tags |
Biological activity : | >3,000 units/mg. Enzymatic activity was confirmed by measuring the amount of enzyme hydrolyzing 1 nmole of p-nitrophenyl phosphate (pNPP) per minute at 37 °C, pH 7.5, using 10 mM of substrate. |
Form : | Liquid |
Purity : | by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 40% Glycerol, 0.88% Sodium chloride, 0.02% DTT, 0.002% PMSF, 0.001% Manganese chloride |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK |
Sequence Similarities : | Belongs to the PPP phosphatase family. PP-1 subfamily. |
Gene Name | PPP1CA protein phosphatase 1, catalytic subunit, alpha isozyme [ Homo sapiens ] |
Official Symbol | PPP1CA |
Synonyms | PPP1CA; protein phosphatase 1, catalytic subunit, alpha isozyme; PPP1A, protein phosphatase 1, catalytic subunit, alpha isoform; serine/threonine-protein phosphatase PP1-alpha catalytic subunit; PP 1A; PP1alpha; |
Gene ID | 5499 |
mRNA Refseq | NM_001008709 |
Protein Refseq | NP_001008709 |
MIM | 176875 |
Uniprot ID | P62136 |
Chromosome Location | 11q13 |
Pathway | ALK1 signaling events, organism-specific biosystem; BMP receptor signaling, organism-specific biosystem; DARPP-32 events, organism-specific biosystem; Dopaminergic synapse, organism-specific biosystem; Dopaminergic synapse, conserved biosystem; |
Function | hydrolase activity; metal ion binding; protein binding; protein phosphatase type 1 regulator activity; protein serine/threonine phosphatase activity; |
◆ Recombinant Proteins | ||
PPP1CA-1015H | Recombinant Full Length Human PPP1CA, His-tagged | +Inquiry |
PPP1CA-13209M | Recombinant Mouse PPP1CA Protein | +Inquiry |
PPP1CA-31049TH | Recombinant Human PPP1CA, His-tagged | +Inquiry |
PPP1CA-5959H | Recombinant Human PPP1CA Protein (Ser2-Lys330), N-His tagged | +Inquiry |
PPP1CA-2523D | Recombinant Dog PPP1CA Protein (2-330 aa), His-Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPP1CA-2951HCL | Recombinant Human PPP1CA 293 Cell Lysate | +Inquiry |
PPP1CA-2952HCL | Recombinant Human PPP1CA 293 Cell Lysate | +Inquiry |
PPP1CA-2953HCL | Recombinant Human PPP1CA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PPP1CA Products
Required fields are marked with *
My Review for All PPP1CA Products
Required fields are marked with *
0
Inquiry Basket