Recombinant Human PPP1CC
Cat.No. : | PPP1CC-29101TH |
Product Overview : | Recombinant full length Human PP1C gamma with N-terminal proprietary tag.Mol Wt 61.27 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene belongs to the protein phosphatase family, PP1 subfamily. PP1 is an ubiquitous serine/threonine phosphatase that regulates many cellular processes, including cell division. It is expressed in mammalian cells as three closely related isoforms, alpha, beta/delta and gamma, which have distinct localization patterns. This gene encodes the gamma isozyme. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Protein length : | 323 amino acids |
Molecular Weight : | 61.270kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCL KSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGG FPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLP IAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGL LCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHD LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAG AMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQ AKK |
Sequence Similarities : | Belongs to the PPP phosphatase family. PP-1 subfamily. |
Gene Name : | PPP1CC protein phosphatase 1, catalytic subunit, gamma isozyme [ Homo sapiens ] |
Official Symbol : | PPP1CC |
Synonyms : | PPP1CC; protein phosphatase 1, catalytic subunit, gamma isozyme; protein phosphatase 1, catalytic subunit, gamma isoform; serine/threonine-protein phosphatase PP1-gamma catalytic subunit; PP1gamma; |
Gene ID : | 5501 |
mRNA Refseq : | NM_001244974 |
Protein Refseq : | NP_001231903 |
MIM : | 176914 |
Uniprot ID : | P36873 |
Chromosome Location : | 12q24.1-q24.2 |
Pathway : | Aurora B signaling, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; DNA Replication, organism-specific biosystem; Dopaminergic synapse, organism-specific biosystem; Dopaminergic synapse, conserved biosystem; |
Function : | hydrolase activity; metal ion binding; protein binding; protein kinase binding; protein serine/threonine phosphatase activity; |
Products Types
◆ Recombinant Protein | ||
PPP1CC-3377R | Recombinant Rhesus Macaque PPP1CC Protein, His (Fc)-Avi-tagged | +Inquiry |
PPP1CC-7001M | Recombinant Mouse PPP1CC Protein, His (Fc)-Avi-tagged | +Inquiry |
Ppp1cc-5056M | Recombinant Mouse Ppp1cc Protein, Myc/DDK-tagged | +Inquiry |
PPP1CC-648H | Recombinant Human PPP1CC Protein, His-tagged | +Inquiry |
PPP1CC-13211M | Recombinant Mouse PPP1CC Protein | +Inquiry |
◆ Lysates | ||
PPP1CC-2948HCL | Recombinant Human PPP1CC 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket