Recombinant Human PPP1CC
| Cat.No. : | PPP1CC-29101TH |
| Product Overview : | Recombinant full length Human PP1C gamma with N-terminal proprietary tag.Mol Wt 61.27 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 323 amino acids |
| Description : | The protein encoded by this gene belongs to the protein phosphatase family, PP1 subfamily. PP1 is an ubiquitous serine/threonine phosphatase that regulates many cellular processes, including cell division. It is expressed in mammalian cells as three closely related isoforms, alpha, beta/delta and gamma, which have distinct localization patterns. This gene encodes the gamma isozyme. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
| Molecular Weight : | 61.270kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCL KSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGG FPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLP IAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGL LCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHD LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAG AMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQ AKK |
| Sequence Similarities : | Belongs to the PPP phosphatase family. PP-1 subfamily. |
| Gene Name | PPP1CC protein phosphatase 1, catalytic subunit, gamma isozyme [ Homo sapiens ] |
| Official Symbol | PPP1CC |
| Synonyms | PPP1CC; protein phosphatase 1, catalytic subunit, gamma isozyme; protein phosphatase 1, catalytic subunit, gamma isoform; serine/threonine-protein phosphatase PP1-gamma catalytic subunit; PP1gamma; |
| Gene ID | 5501 |
| mRNA Refseq | NM_001244974 |
| Protein Refseq | NP_001231903 |
| MIM | 176914 |
| Uniprot ID | P36873 |
| Chromosome Location | 12q24.1-q24.2 |
| Pathway | Aurora B signaling, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; DNA Replication, organism-specific biosystem; Dopaminergic synapse, organism-specific biosystem; Dopaminergic synapse, conserved biosystem; |
| Function | hydrolase activity; metal ion binding; protein binding; protein kinase binding; protein serine/threonine phosphatase activity; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPP1CC Products
Required fields are marked with *
My Review for All PPP1CC Products
Required fields are marked with *
