Recombinant Human PPP1CC
Cat.No. : | PPP1CC-29101TH |
Product Overview : | Recombinant full length Human PP1C gamma with N-terminal proprietary tag.Mol Wt 61.27 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 323 amino acids |
Description : | The protein encoded by this gene belongs to the protein phosphatase family, PP1 subfamily. PP1 is an ubiquitous serine/threonine phosphatase that regulates many cellular processes, including cell division. It is expressed in mammalian cells as three closely related isoforms, alpha, beta/delta and gamma, which have distinct localization patterns. This gene encodes the gamma isozyme. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Molecular Weight : | 61.270kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCL KSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGG FPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLP IAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGL LCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHD LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAG AMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQ AKK |
Sequence Similarities : | Belongs to the PPP phosphatase family. PP-1 subfamily. |
Gene Name | PPP1CC protein phosphatase 1, catalytic subunit, gamma isozyme [ Homo sapiens ] |
Official Symbol | PPP1CC |
Synonyms | PPP1CC; protein phosphatase 1, catalytic subunit, gamma isozyme; protein phosphatase 1, catalytic subunit, gamma isoform; serine/threonine-protein phosphatase PP1-gamma catalytic subunit; PP1gamma; |
Gene ID | 5501 |
mRNA Refseq | NM_001244974 |
Protein Refseq | NP_001231903 |
MIM | 176914 |
Uniprot ID | P36873 |
Chromosome Location | 12q24.1-q24.2 |
Pathway | Aurora B signaling, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; DNA Replication, organism-specific biosystem; Dopaminergic synapse, organism-specific biosystem; Dopaminergic synapse, conserved biosystem; |
Function | hydrolase activity; metal ion binding; protein binding; protein kinase binding; protein serine/threonine phosphatase activity; |
◆ Recombinant Proteins | ||
PPP1CC-2401H | Recombinant Human Protein Phosphatase 1, Catalytic Subunit, Gamma Isozyme, His-tagged | +Inquiry |
PPP1CC-13211M | Recombinant Mouse PPP1CC Protein | +Inquiry |
PPP1CC-3559R | Recombinant Rhesus monkey PPP1CC Protein, His-tagged | +Inquiry |
PPP1CC-3377R | Recombinant Rhesus Macaque PPP1CC Protein, His (Fc)-Avi-tagged | +Inquiry |
PPP1CC-3004H | Recombinant Human PPP1CC Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPP1CC-2948HCL | Recombinant Human PPP1CC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPP1CC Products
Required fields are marked with *
My Review for All PPP1CC Products
Required fields are marked with *