Recombinant Human PPP1R14B Protein, His-tagged

Cat.No. : PPP1R14B-461H
Product Overview : Recombinant Human PPP1R14B Protien(NP_619634)(1-147 aa), fused to His tag, was expressed in E. coli.
Availability December 20, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-147 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
AA Sequence : MADSGTAGGAALAAPAPGPGSGGPGPRVYFQSPPGAAGEGPGGADDEGPVRRQGKVTVKYDRKELRKRLNLEEWILEQLTRLYDCQEEEIPELEIDVDELLDMESDDARAARVKELLVDCYKPTEAFISGLLDKIRGMQKLSTPQKK
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).
If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).
Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
Gene Name PPP1R14B protein phosphatase 1, regulatory (inhibitor) subunit 14B [ Homo sapiens ]
Official Symbol PPP1R14B
Synonyms PPP1R14B; protein phosphatase 1, regulatory (inhibitor) subunit 14B; PLCB3N; protein phosphatase 1 regulatory subunit 14B; PHI 1; PNG; SOM172; phospholipase C beta-3 neighboring gene protein; phospholipase C-beta-3 neighbouring gene protein; PHI-1;
Gene ID 26472
mRNA Refseq NM_138689
Protein Refseq NP_619634
MIM 601140
UniProt ID Q96C90

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PPP1R14B Products

Required fields are marked with *

My Review for All PPP1R14B Products

Required fields are marked with *

0
cart-icon
0
compare icon