Recombinant Human PPP1R14B Protein, His-tagged
Cat.No. : | PPP1R14B-461H |
Product Overview : | Recombinant Human PPP1R14B Protien(NP_619634)(1-147 aa), fused to His tag, was expressed in E. coli. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-147 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | MADSGTAGGAALAAPAPGPGSGGPGPRVYFQSPPGAAGEGPGGADDEGPVRRQGKVTVKYDRKELRKRLNLEEWILEQLTRLYDCQEEEIPELEIDVDELLDMESDDARAARVKELLVDCYKPTEAFISGLLDKIRGMQKLSTPQKK |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Gene Name | PPP1R14B protein phosphatase 1, regulatory (inhibitor) subunit 14B [ Homo sapiens ] |
Official Symbol | PPP1R14B |
Synonyms | PPP1R14B; protein phosphatase 1, regulatory (inhibitor) subunit 14B; PLCB3N; protein phosphatase 1 regulatory subunit 14B; PHI 1; PNG; SOM172; phospholipase C beta-3 neighboring gene protein; phospholipase C-beta-3 neighbouring gene protein; PHI-1; |
Gene ID | 26472 |
mRNA Refseq | NM_138689 |
Protein Refseq | NP_619634 |
MIM | 601140 |
UniProt ID | Q96C90 |
◆ Recombinant Proteins | ||
PPP1R14B-2754H | Recombinant Human PPP1R14B Protein, MYC/DDK-tagged | +Inquiry |
PPP1R14B-4275R | Recombinant Rat PPP1R14B Protein, His (Fc)-Avi-tagged | +Inquiry |
PPP1R14B-13220M | Recombinant Mouse PPP1R14B Protein | +Inquiry |
PPP1R14B-7007M | Recombinant Mouse PPP1R14B Protein, His (Fc)-Avi-tagged | +Inquiry |
PPP1R14B-4616R | Recombinant Rat PPP1R14B Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPP1R14B Products
Required fields are marked with *
My Review for All PPP1R14B Products
Required fields are marked with *