Recombinant Human PPP1R14D protein, His-tagged

• Cat.No.: PPP1R14D-294H
• Product Overview: Recombinant Human PPP1R14D protein(1-145 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-145 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
• AASequence: MLSSSPASCTSPSPDGENPCKKVHWASGRRRTSSTDSESKSHPDSSKIPRSRRPSRLTVKYDRGQLQRWLEMEQWVDAQVQELFQDQATPSEPEIDLEALMDLSTEEQKTQLEAILGNCPRPTEAFISELLSQLKKLRRLSRPQK
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: PPP1R14D protein phosphatase 1, regulatory (inhibitor) subunit 14D [ Homo sapiens ]
• Official Symbol: PPP1R14D
• Synonyms: PPP1R14D; protein phosphatase 1, regulatory (inhibitor) subunit 14D; protein phosphatase 1 regulatory subunit 14D; CPI17 like; FLJ20251; GBPI 1; gut and brain phosphatase inhibitor 1; MGC119014; MGC119016; PKC dependent PP1 inhibitory protein; PKC-dependent PP1 inhibitory protein; gastrointestinal and brain-specific PP1-inhibitory protein 1; GBPI1; GBPI-1; CPI17-like
• Gene ID: 54866
• mRNA Refseq: NM_001130143
• Protein Refseq: NP_001123615
• MIM: 613256
• UniProt ID: Q9NXH3