Recombinant Human PPP1R14D protein, His-tagged

Cat.No. : PPP1R14D-294H
Product Overview : Recombinant Human PPP1R14D protein(1-145 aa), fused with N-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-145 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
AASequence : MLSSSPASCTSPSPDGENPCKKVHWASGRRRTSSTDSESKSHPDSSKIPRSRRPSRLTVKYDRGQLQRWLEMEQWVDAQVQELFQDQATPSEPEIDLEALMDLSTEEQKTQLEAILGNCPRPTEAFISELLSQLKKLRRLSRPQK
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name PPP1R14D protein phosphatase 1, regulatory (inhibitor) subunit 14D [ Homo sapiens ]
Official Symbol PPP1R14D
Synonyms PPP1R14D; protein phosphatase 1, regulatory (inhibitor) subunit 14D; protein phosphatase 1 regulatory subunit 14D; CPI17 like; FLJ20251; GBPI 1; gut and brain phosphatase inhibitor 1; MGC119014; MGC119016; PKC dependent PP1 inhibitory protein; PKC-dependent PP1 inhibitory protein; gastrointestinal and brain-specific PP1-inhibitory protein 1; GBPI1; GBPI-1; CPI17-like;
Gene ID 54866
mRNA Refseq NM_001130143
Protein Refseq NP_001123615
MIM 613256
UniProt ID Q9NXH3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PPP1R14D Products

Required fields are marked with *

My Review for All PPP1R14D Products

Required fields are marked with *

0
cart-icon