Recombinant Human PPP1R14D protein, His-tagged
Cat.No. : | PPP1R14D-294H |
Product Overview : | Recombinant Human PPP1R14D protein(1-145 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-145 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | MLSSSPASCTSPSPDGENPCKKVHWASGRRRTSSTDSESKSHPDSSKIPRSRRPSRLTVKYDRGQLQRWLEMEQWVDAQVQELFQDQATPSEPEIDLEALMDLSTEEQKTQLEAILGNCPRPTEAFISELLSQLKKLRRLSRPQK |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | PPP1R14D protein phosphatase 1, regulatory (inhibitor) subunit 14D [ Homo sapiens ] |
Official Symbol | PPP1R14D |
Synonyms | PPP1R14D; protein phosphatase 1, regulatory (inhibitor) subunit 14D; protein phosphatase 1 regulatory subunit 14D; CPI17 like; FLJ20251; GBPI 1; gut and brain phosphatase inhibitor 1; MGC119014; MGC119016; PKC dependent PP1 inhibitory protein; PKC-dependent PP1 inhibitory protein; gastrointestinal and brain-specific PP1-inhibitory protein 1; GBPI1; GBPI-1; CPI17-like; |
Gene ID | 54866 |
mRNA Refseq | NM_001130143 |
Protein Refseq | NP_001123615 |
MIM | 613256 |
UniProt ID | Q9NXH3 |
◆ Recombinant Proteins | ||
PPP1R14D-4618R | Recombinant Rat PPP1R14D Protein | +Inquiry |
Ppp1r14d-5063M | Recombinant Mouse Ppp1r14d Protein, Myc/DDK-tagged | +Inquiry |
PPP1R14D-294H | Recombinant Human PPP1R14D protein, His-tagged | +Inquiry |
PPP1R14D-4277R | Recombinant Rat PPP1R14D Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPP1R14D-2944HCL | Recombinant Human PPP1R14D 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPP1R14D Products
Required fields are marked with *
My Review for All PPP1R14D Products
Required fields are marked with *