Recombinant Human PPP1R17 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | PPP1R17-3675H |
| Product Overview : | C7orf16 MS Standard C13 and N15-labeled recombinant protein (NP_006649) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | The protein encoded by this gene is found primarily in cerebellar Purkinje cells, where it functions as a protein phosphatase inhibitor. The encoded protein is a substrate for cGMP-dependent protein kinase. An allele of this gene was discovered that increases susceptibility to hypercholesterolemia. Two transcript variants encoding different isoforms have been found for this gene. |
| Molecular Mass : | 17.9 kDa |
| AA Sequence : | MMSTEQMQPLEVSEDRLDKLDPRCSHLDDLSDQFIKDCDLKKKPRKGKNVQATLNVESDQKKPRRKDTPALHIPPFIPGVFSEHLIKRYDVQERHPKGKMIPVLHNTDLEQKKPRRKDTPALHMSPFAAGVTLLRDERPKAIVEDDEKDGDKIAITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | PPP1R17 protein phosphatase 1 regulatory subunit 17 [ Homo sapiens (human) ] |
| Official Symbol | PPP1R17 |
| Synonyms | PPP1R17; protein phosphatase 1, regulatory subunit 17; C7orf16, chromosome 7 open reading frame 16; protein phosphatase 1 regulatory subunit 17; G substrate; GSBS; G-substrate; C7orf16; |
| Gene ID | 10842 |
| mRNA Refseq | NM_006658 |
| Protein Refseq | NP_006649 |
| MIM | 604088 |
| UniProt ID | O96001 |
| ◆ Recombinant Proteins | ||
| Ppp1r17-5067M | Recombinant Mouse Ppp1r17 Protein, Myc/DDK-tagged | +Inquiry |
| PPP1R17-3675H | Recombinant Human PPP1R17 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| PPP1R17-3433HF | Recombinant Full Length Human PPP1R17 Protein, GST-tagged | +Inquiry |
| PPP1R17-7011M | Recombinant Mouse PPP1R17 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PPP1R17-13226M | Recombinant Mouse PPP1R17 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PPP1R17-7974HCL | Recombinant Human C7orf16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPP1R17 Products
Required fields are marked with *
My Review for All PPP1R17 Products
Required fields are marked with *
