Recombinant Human PPP1R17 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | PPP1R17-3675H |
Product Overview : | C7orf16 MS Standard C13 and N15-labeled recombinant protein (NP_006649) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is found primarily in cerebellar Purkinje cells, where it functions as a protein phosphatase inhibitor. The encoded protein is a substrate for cGMP-dependent protein kinase. An allele of this gene was discovered that increases susceptibility to hypercholesterolemia. Two transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 17.9 kDa |
AA Sequence : | MMSTEQMQPLEVSEDRLDKLDPRCSHLDDLSDQFIKDCDLKKKPRKGKNVQATLNVESDQKKPRRKDTPALHIPPFIPGVFSEHLIKRYDVQERHPKGKMIPVLHNTDLEQKKPRRKDTPALHMSPFAAGVTLLRDERPKAIVEDDEKDGDKIAITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | PPP1R17 protein phosphatase 1 regulatory subunit 17 [ Homo sapiens (human) ] |
Official Symbol | PPP1R17 |
Synonyms | PPP1R17; protein phosphatase 1, regulatory subunit 17; C7orf16, chromosome 7 open reading frame 16; protein phosphatase 1 regulatory subunit 17; G substrate; GSBS; G-substrate; C7orf16; |
Gene ID | 10842 |
mRNA Refseq | NM_006658 |
Protein Refseq | NP_006649 |
MIM | 604088 |
UniProt ID | O96001 |
◆ Recombinant Proteins | ||
PPP1R17-13226M | Recombinant Mouse PPP1R17 Protein | +Inquiry |
Ppp1r17-5067M | Recombinant Mouse Ppp1r17 Protein, Myc/DDK-tagged | +Inquiry |
PPP1R17-7011M | Recombinant Mouse PPP1R17 Protein, His (Fc)-Avi-tagged | +Inquiry |
PPP1R17-0134H | Recombinant Human PPP1R17 Protein, GST-Tagged | +Inquiry |
PPP1R17-3675H | Recombinant Human PPP1R17 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPP1R17-7974HCL | Recombinant Human C7orf16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PPP1R17 Products
Required fields are marked with *
My Review for All PPP1R17 Products
Required fields are marked with *
0
Inquiry Basket