Recombinant Human PPP1R1B Protein (1-168 aa), GST-tagged
| Cat.No. : | PPP1R1B-2118H |
| Product Overview : | Recombinant Human PPP1R1B Protein (1-168 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Neuroscience. Protein Description: Full Length of Isoform 2. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-168 aa |
| Description : | Inhibitor of protein-phosphatase 1. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 45.7 kDa |
| AA Sequence : | MLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPGEEPQRPSPSEPGT |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | PPP1R1B protein phosphatase 1, regulatory (inhibitor) subunit 1B (dopamine and cAMP regulated phosphoprotein, DARPP-32) [ Homo sapiens ] |
| Official Symbol | PPP1R1B |
| Synonyms | PPP1R1B; DARPP 32; FLJ20940; DARPP-32; |
| Gene ID | 5503 |
| MIM | 604399 |
| UniProt ID | Q9UD71 |
| ◆ Recombinant Proteins | ||
| PPP1R1B-26806TH | Recombinant Human PPP1R1B | +Inquiry |
| PPP1R1B-5421H | Recombinant Human PPP1R1B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| PPP1R1B-4280R | Recombinant Rat PPP1R1B Protein, His (Fc)-Avi-tagged | +Inquiry |
| Ppp1r1b-2634R | Recombinant Rat Ppp1r1b, Phosphorylated | +Inquiry |
| PPP1R1B-390HF | Recombinant Full Length Human PPP1R1B Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PPP1R1B-2939HCL | Recombinant Human PPP1R1B 293 Cell Lysate | +Inquiry |
| PPP1R1B-2940HCL | Recombinant Human PPP1R1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPP1R1B Products
Required fields are marked with *
My Review for All PPP1R1B Products
Required fields are marked with *



